8__PAGEZEROH__TEXT@@__text__TEXT__cstring__TEXTPr__symbol_stub4__TEXT  __const__TEXT(`'__DATAP@ __data__DATAP@__dyld__DATAWG__la_symbol_ptr__DATAWG__nl_symbol_ptr__DATAhZphJF__const__DATAZJ__bss__DATAas__common__DATAPd|__DATA____common__DATA__8__LINKEDIT`( /usr/lib/dyld \$XF/System/Library/Frameworks/CoreFoundation.framework/CoreFoundation TXFb,/System/Library/Frameworks/Foundation.framework/Foundation LXF/System/Library/Frameworks/UIKit.framework/UIKit PXF/System/Library/Frameworks/LayerKit.framework/LayerKit XfXF@/System/Library/Frameworks/CoreGraphics.framework/CoreGraphics 4XF/usr/lib/libobjc.A.dylib 4՜XF  /usr/lib/libssl.0.9.7.dylib 8՜XF  /usr/lib/libcrypto.0.9.7.dylib 4mEWF^/usr/lib/libSystem.B.dylib 8%XF/usr/lib/libgcc_s_v6.1.dylib ( Flibarmfp.dylib`tC P,bA#wE&iPYT@! p --WW@- pM <1 41 ,1 00S>1 0 0 !00000000S000000S 000/000S 000/ 0/p0S X00 0 m0 a pZhZЮlZM00 00/S00000000S00 0 Ѝ/@- p -M RM0   0\1 . #@P lFl>V0\V [V ?VP1 @/\@ *.P+ ^! 'P/P !`! P   R/R   00 @?T P*U  @T  P/U @?T @T P*U P?U  P PP0\S0!0 0S `0 @[S  ^P 0S 0 S PP 0S \ @ `.T`@@$@^ @@@T/T @@`T`T Z ][ @!T P^UP`\U` P`x /Pq-[][ `\P` `  ` HlF X H\E XP]Uu!P ^PK QPF ]P!P@ ^P= C! 6 ]P . ]P \PM \P P$ 00000SG y00G *V  .R^G P @\ P00 0 P [\ P`` V 0`S @- pd00 S P  @0@@V=0" 0倀 0J1a`P0@-px00Sl00hP 9@T H S880$ 0吀萀@@h! j됀axZa@-p@ 吀@- pMLM@P`p304 0:VV8@83`V P0<0  j20 Pm@201S  S  S<0000 *00ݽ200#+l20P p2m:8 ᯽P ᮽ820(1Sm 0(j늽@刽| P忽 >j~@GЍQP`P[8@400 0!rP=PudPU`?@/T D@@/T @`Y/7呹x`D00SD0 0/^ C`@᳹0#fV`%@`0S D  R0/S 0/S /X @@0^0 ./0 S0㖃 }E@ ``ATL՚Р@@J ` @ $j0 00 B Р  0YH<  0`E@ Р(AT6@L?=P80080 0BS [ ,5 %3F Q 0@@厚РL劚Р@@`H< 0(4D@(AT @00MD  TL PeЍLP8``8`P@@P@b`@@H< 0C@(AT%@P400405 @ ᠙0 00 B Рx  0ոH<  0C@ Р(AT @ 8PD0eᶸP4``4`  3H< P@lH@PPU@00 D@R A <0噸<勸@8 40d(\ 00 000000S^咙8:@Ph`<2 i0M  dЍG 0 008040 D `0` /R` RL?`@T0 L]@00 BРL00S L0 ?Q Q "0D d(~00000 00 000S00 @BРD*0 0g``Bo``Bi``Br``BX``V@@ ``ATaaxZ P|Zpбa @Pа0вa@@@P@- p-@P`"T 0'SPm 0S 00  0Rb  R  Q ``S$ 0 S S0S 0S0/S @0/S0S HP410.P 1J- 00 -`0 .000 .Pߎ@܎|00 . G G`L0`-׶նĎ@ . Ga|ZD@-p00@PS-0000S-0000!.@T h00.P  ,D0DDv]ሎ@ᅎ00 .밀a|Zа0@-pM00@S[-0000SR-p00`00  .P @0,db$00 ,G␀G␀a|ZD@-p00@P '.P #-P00i@P#尀$00^P尀Za@-p0P @Y,00t00P t\0@M,00H00P V4@'00吀@!00吀a|ZZa@-pM10 S @PP Ze-PT GⰀ0",D1<1T-PFU)0KJ,K\K10@ -GⰀ00ᴍ@ -GⰀ00ᨍ@ -GⰀPPᜍ\@ -GⰀP00ᐍ,0 -GⰀGⰀGⰀaP PPa@- pት　@-p00P @  ,P+@尀谀aL@-p:@P,!ᰀ@-p0@S bP ^ P Z$P VT됀Q됀@- p-@P,P ` ,P 'P0 R (P```@- p$M@P 0 ,P  P (0 R>(000C000(1S Xa 0(00(0 -00000(1S $@ `0S  0PddS @` LL0r0D)a G G(0 0(0xZгa@- pt10 0U 0  H0 .RH   @   @@ .\2 ^@@(   @@P``P .R  X  000 ( Z@- p -8M8<, 400P0ᥴ>00,@HP (0H 00@P0L0@0D00PP`V00lQRpSSTTTHU00 FR:@T! =0``0@/% ` V@H0S@0S H0PU<HP,00PU4H00S8HG $00᳀@!PDP]UP"U P`;U00=U``,U `DP ;X =X 00᳀@!D]X"X 0;X  =X00,X @=X ;X  `PL@`PL@`00᳀@ @;X "X `PPLPz@`PPLPPs@`LPo@00᳀@`PLPc@ap ;Xm 00᳀@f@PQ^ @"T@`PPPF@D;X `=@`:l00᳀@`1@/ D`V? @`V< H` `VL`V P`V D@OH` LPJ$`Р@0D``CVV) D\P#L`V P`V LP`Z H`P L``.VL`P!H``РLPH``РV$ D0PL`V P`V L`P V H`P ڲLPH``РLPH``РVV hDP,L`V P`V LP`Z PL``J K Р L ߲ e;p `H`g``HZ`H``Р`+K DвPEf b`` `L`VW P`VT L`P VP P`L `F 0 C Р L ᤲ G  ᤲ `6 2  P6 0H 060 0l  0kH`P`H``Р2`*  `D偲P`H0 ``Р#`Р РРРРРР@D`H`` 0`CРD P00 ^ ``РFXV H V00Hx q^G d50(1S TE^+P850(1S ,:^<'P 50(1S .^ <8P 0.S`40(1S ^0 SP .PZ P  .Q Q 0 Z 0S  ``0`S 30(1S ]X30(1SX`㼃 P`V:`0&Z\30(1S h]0.S ၱP<~P00< 0.St30(1SH00ST H0P0/S `e4 ᖱPx20(1Sv 4 ]3HG H00S6 80'Pb 80$ GHPUZ $0SN0(08 ( G(PQ ( RU 80()10(1S@ \] G ` ``@P ``PPU ,,1,,Ұ빰븰<ܰP H00H< Z]H0` 0 =+]XL ]`V( ( hPP(QU) ,0hh塰눰80&(徰Q`PP(QU l]H00S SZZ0 0`pxZ 0@P`Z@p@- pM@P0`\ \( Q ^# q Q R ᲰP0 /R`| ᭰P0S TЍ0ЍZ@- p@ P 6`$$2V`0 SS0 C/@- p -@M$@D P.=0 1B 0Р$0&`P% WP(.+,$0'P  0(0 0( 0(0 , X .G$0 u'P 000A40(0S00000(0S08040 80X M@D 0FЍP40040(X80080( S40S 04  0B@0Р00 < 0< Z M0G0` D 0ЍP 0@帯00(Z<00<0( S4@X @D3@4 ɯ40T4@PD`@@ 0@ #(U 0@ #" @  dP$$_P X @`40V@0@D230?T0 2@T嘯0 T0H0 Tx@@P` e$b ```@T0TT@@ @L@ @ uH00#\ TPPEPPPXPP@0` B$? ^P=00$P V PP X0R;000  PX00X0@0 0@0X0T S 000   0L S#G 0(0(0S@(040O +0忮릮@@t`P +h0LL岮뙮 0@ 000000` @40V[=Z 0a*00S0000 0 5P G_P 9W: S 000>00S 0S0 00㛃`=00S } GX 0SGD ڪM0G000$ 05WЍ00# 008000T ,0:0S 0000000 0{ 0~ 0(0 00,0$00 `G$G0 ]<0 Q`` `0$ R0$0Sf Vd 000 *0 *00```8R` `Vb00:0S  l`0h``00 X%Pf`P ̠̀ $P    y$܀Xթ`=V j` `\fV`P Ԁ Uff yVd X 5R$ 00:0S 6XR`H V 0p~\|8888z8D{8R0R娩i`(aV "Vff`Ph ff`P_z QQ冩(i`(aV Vee`PFa ee`P=X 7X  Q`Qbh`(aV Uee`P"= ee`P4 QQ@h`(aVk p Uee`P^ 000H6Se (~((l(~ll((l((lll(~(((~l((l(}ll(~(~llllllll((~(~ltllllllllllll(글80X% oX 0X MeP ,G Ge?e`P (Q%Q廨e`(aV \ 5U+e#e`P yee`P m|e` aV  P\e` aV/U$`j`X`X5 X# X0hP`Ptd`(aV @ Tdd`P4Odd`P+FPP\40 1S  A8 0X0`&`Pd` aVT(`j)XB X# X=PP!c`(aV Tdd`Pdd`P(`jP 4#(`j$`j`V Z(`j$`j`V O$`j`VI(`j`[TXX ]K0[  T(Q0* +GT$b` aV) +=T10(1S. /00 X *0 .R/  0 R:`a`(aV (`jT|a` aVO`*`L XH,)TlFl6X'Xn XH XiTOLOo``(aV ,Scc`P/Jcc`P&A7XEOOK<``(aV Scc`P &xZcc`P8Oh S'T``(aV Scc`Pcc`P`` aVlO` ` `X aO`r `Vo #((X TmS/XN $0:0S 0/ ∀Ḁ :X? S= S: (P p@P00S/S 0 000 B Р  / <(X (SX(X ( 0S `$X2צ J Р ̦Z/X[ 0S 0/X.0X] ((X hRD(X P R `l X( R6X(Xs XH XjNNDc`(aV Rbb`Pbb`P07XENTNtd`(aV Rbb`Pb~b`PjN` Re`(aV \uRkbcb`PbbZb`Pץ@`pe` aV`6``PS ( LL峣$n`(aV -P!```Pq0` ``Pe@P7X>HKK刣n`(aV p P__`PFa__`P;V(T__`P (,(FPKX  GpĠ帏 XKԀ TX) <o`(aV O__`P **__`P **꠻лZX X Z hmK̀$ Ò$ 6X+Xh XQ X`XKUKPn`(aV eO?Y_Q_`P4N_F_`P7X8\0K-Kâm`(aV =O1_)_`P %__`Pu K`$ ?O _`Pc~ꈢ`܌ X8JȀ(} XJ 6X+Xd XO X]JJeo`(aV N^^`P#>^^`P37X5JJ=Lo`(aV dN^^`P^^`P J/Nt^`P XlJN(e PT00#X #[80S  Z[ ( C X荟(X _N8VG XY m``V J ,`jq|m`4aV ,`j{i,`j<mZPFѡ0,`j `MN姡l`(aV !N^ ^`P c} ^]`P Uo ZXXV   8P E TNZ 8` F< `4MI8I80Pp[ & MZ K MIM``Ѐ 8 G 0eЍz080 C0 h`~:00S 0D @0pxD x-M 0MЍh:0 1S xdI(G](Z` %x  0MPIi`(aVB  `MV]N]`P5 ꐽX0px^0,`j fMXi`(aV p :M0](]`P ~$]]`P r]]`P d~à0x02Z"  0'MH\`P HbH\`P ;U갽`# ` `g`(aV L\g` aV ` ,`jot`V ~P#  Ll~P нP0,`j \L\`P ** D\`P*```H6VI0(~((l(~ll((l((lll(~(((~l((l(}ll(~(~llllllll((~(~ltllllllllllll(fXf꺟0xT50T0S'080C0f`0 媟50(1S $L\TPTPU 8PMPPP< 05LЍTPPUTPPUrP80 M00000 0L ЍᦟP TPDQU@TP8 0SPP尀X4 PP"G xZSPTPU$,TP8 0xSP\QU XSP(QU K K{P O KP尀XPP"G F Ă(X[,G ,0: K"G 00E0x` \2\\ P2DD <2,, (2ߞ 2ٞG[[ {K봁 X Ǟ `2-1֞뽞 0M ````Xl!G띞מ hVK尞a`(aV^ 0*K[[`P mꀾĠS*'~K[,G (0:K/00 X*꠾_噞 KZ`P>Yx[ m*8xZ@p0 @`й @P @0@ZZP`p0Z0@@- p -M@ 000 G"P<0X0S<0\0S+ PU( 0S !|P J`GP CAPVPV X `PPU ` PU' `0/S ጞP  J`P PVPV X `P`0%0$00SS 0S 0SMPUJ 0$ `V v'՝0,PZ QJ@T&0G ՝P ѝϝPXPX Z PPU ܀ v@T P峝P ᭝U @00PSPS 990, Rr I@(AT I @@D@@T xI@T 0% 0    00Y0P 00bx0G000P80!1Q S 00#R R\P ,`j000$7uqOmL80,1S; 0S8xG⛝P4$0:0  XS S0S 0 PS ,0: I0S ̰` |I`Z "S~oI`V瘮t`` `|```600S`0SE0SN ", G,P*ݜ=W: S"00 A,0: Р  Z P,`j @ 0I`V "`Z"`R, 0 I 箜 pE HDZ"5DZ Vs  Z (!` Za 8HZ ""`VR  Z "400S 0s V ,0:xuP L400P0P ,$ R  ,0:P u0S 0SV ,`ji00dpZ Z 6Z 000PUh300SS H30, r D3RC@(ATC00C0@T PP ߛݛUB@1A@T*"0S@$ ;H@T PěP ᾛU @000 :G B@1A@T 10! R  31S ࠳S\"^6G J/+1fM00~0\, * tG| 0s,0: pG0SI 10(1S ,0:@G,`ja00oZZQ ZO 6ZM F$@hPUI @PPEP@Tg [ +X@@@TZ N|G,@00C0@TO CxZ@ap0Z@ @`Pp@- p -M @Qg P`10!1Q S 003R R\PM0SG  00SPP 0PCР0S: 0/S0S4 $ 0ۚ10(1S G00(1S  0 GwP$ 000 0 r o 8oᥚ`VG L 0ᦚ0([ , G`V xZZ@@- p -MM@P`t4 * N V0t0$0:(0:00:`$0SX400Sp t`"V(40H1Sv 40T0Sqd`P,`jtPOjp L PH`C@@T C@@T8ᒚP40p F#p@T P XV"`"Vyu0 |F p@T P XV"`"V_[ cF`p@T P XvV"`"VD@p@T ՙP љϙXeV"`"V1-Pva``0V``P0 a``Va`,aV   t9P""P ` `t &`V"`"V000 UP |^10(1S |E(0:t P t0( *, *P,0:t G {@J@b@{@dt0, *G Kqp f PbCqp ^ PZxZ0`@- p -@P(`q0FSx`qF 0:0Sn0:sU0:P 0@ *00:   PQ0 R 0ZJ0 R  X [D10(1S 0HEZ [10 1S ZEZ00 0 00 0 00 0 0 S0@ 800  0C *00:   0 R 0xZ0ZZ@- pMM@Pᴘ`UU- ᬘ00_p` PP00 ᗘ00 1S  ʘP@GЍx00(1SGЍ0L DGЍ4DGЍaxZ@- p -M@P `V{`D2V|PPO `6VrP`Um02S 03SP࡟ 3 bP PU3U:*G  G 0( 0 0 B  RC*0 !"0B 0 B  R: R7 R P2 9P r`ۗV@T @З2TG ɗG G 7ὗG 嵗G 谗G Z@- pPM@01 P6P0 P+ 1 .@0 0$P 0ᐗPᑗ `xVL+@LT @m2T G G7b G @@- p-M@P`c JZ@T02S@0S @0@S 20 0 @0Sh 0  !    !0A   ,R0S@&G F00<10 0 0,B,0 B ! 0᳀@0,S00 0 0  #00C 0 40ʖGĖ&G&G7깖G贖'G@PZ@- pM@00PᲖ 0`ᙖV L@T @厖2T G7 G腖 G`@- pM@Pዖ  `rV %@T @5T e02S G7 G[ GW Gp@- pM@PoPY `@V @T @53T G7 G, Ga@- pM@vP1 `V @T @5T 01S G7 G G G@- pM@HP `V @T @5T ݕ01S G7 Gӕ Gϕ G@- pMM@P`ѕ OḕX6 k@T405S7 A@P2 ݕP6 tؕP: dӕP5 TΕP9 DɕP= 00儕GЍ7GЍyGЍsGЍ@@jGЍ@@aGЍ@@XGЍ@@OGЍ00FGЍ@- pMM@P`? &X @T05S @ቕᆕ@Pl GЍ7GЍGЍGЍlGЍ 0@- pMM@P4` m֔X @T05S! {0 8s@徔TGЍ@@7GЍ诔00GЍ觔00GЍ00GЍ@@-p@P  4ԔP0S  0᐀I㐀PZ@- p -M@Q0x|HG ePU `Z00F SW<P <rP @0@@@@0@:04 @G ,d'P,@'-l4L@(AT 4@L,ᡔ릔(Pᛔ렔@ᖔ뛔`ᑔ떔ጔᐔ0PS0 0 XGVdPP(0`CV`4<0(1S ?;(  0K@0t0x|@`P00@@tm@;0(1SX0SR0S 0<S+x;0(1So "@ k8PP퀠`00`40( @@@000@,廓0<qP4 ,pP퀠`0%Pj`(aVF ?`i ik80 0`400`( @@@@@,吓<qP 0@@@@8@@@T8@@8@,=@@0@<t0G G jP qP hqP cqP  ^qP  @ @$@PwP  dP@@@90(1S T ?0S 0;S 00 R ;R ;R A`@P00k80(1S k?80(1 S @T@" p]?P}P @@=@@ @" @M?@@kP.G@(AT ??.qPU G@(AT 1?ג G P pG@(ATђƒ G H:,G@(AT X?/@70(1S 0?*  @TF@(AT~ᤒ噒 G ᆒP ` Vp @6# ? `F600,60(1S p>0S 0:S 0S 0:S 0S 0:S0SA  ԒX :X [ :[30S0 ,50(1S l 0>DHL @P@T`@X@@\@`@@d@D⪒`D@(AT r>@ᑒ᎒ዒ@ThD@(AT ^> MpP PEpP P 00S20(1S T > xi@ 0S00000H000៑oP @$@P@ @H$0@00000H0$  0ᆑoP5 $@(G h=G "\0 =G P`퀠`iH0l =G @ @@ @A G D9 G 00@@:@@7=0% G `t=# G 0CS%,SI0,SF00爁SL DR=$r0S  @xZ@P`@`p0`[@*p0P@-p@P 0@ R  0@ R   R R @0S0᐀00@- p -tM@P姐,P ,n@U@4@P# @@ @<@N刐00 =G $ ϐP冐,nP @Tx,nP 0lS dS -S,=0(1S x <40Y@(@+T=0(1S H <40@(@0(0H=0(1S <40@(@0(08<0(1S <0(040,@Li?00(0S00000L@(AT 0p<X吐X @@@P@@@`_@P@@@` @@0(0PPsX``xX`wV``rZ``rV```wV```sVxV`` ``rV```wV`` @sT``xTP@0(Xd 0</Xd @@@P@@@`JZI㬺 ᓏP  Z ZV 0H S0H  ,/B, 0C S ᰀS7 ԉ(X8 ܉  ;P   [Z Z/ ZCЀZ 0 J!H (X H4(0HZ  ;孏P  *H{H@P`@ @` \E\0`EPP兠p80庠@P:U@0P<( P P 00 BРᜋᙋ000 B Р ፋ S> ቋ  Q>8GW>800 0"8040, 0"408 0 T;> G ;>8GA>800 0"8040, 0"408  0@DT0$04GD0H0  D H HG Ď aa0  0 S3@0GH0WG W4.*0$100000000S 30S 30S 30S 0# GWFW !  R X#  R D#  R 0#00S 0 0# FWEWDW   R "  R "  R "00S 0 0p" DWCW !P  Ro "  Rl "  Ri !00Sf 0 0! CWBW   RP |!  RM h!  RJ T!00SG 0 08! 0B WAW$@W$"# !        00(1S+G0?0=0;090]0[0Y0W0~0|0z0x00000000@ q6G b(xZ@- p-@Pω`a0T@@0UPP@@73 62 벉|0Q`U*@GT᪉@73 ᨉ롉`Pa0!ḉ @  H6#;#24#5#1#3##/0P0/@-p@ʼnÉ됀@- p -@P0`/91S 1C/P X4 0S0S/ 0P  B 1`C V' 0S 0/0!R R V 0 R00 V 0S 0@-p@0!P8 P尀@- p -@1P`S0S   /P0 S SPZ /0,B,S 0S 0"S/@- p0P0က@- pM؈@P``000073 62 뿈0APT*GXˆ᷈73 ᵈ뮈P@`0!ň Ѝ`HH00 0S  R $  ,#Q/Z@- p 0P0က@- pM}@P``000073 ᥈62 ňd0APT*GXg\73 ZSP@_`0!j Ѝ H@- p-@P0`/1@S 1C/P X 0S0S@- p -M@P`00/҈1@S 1C/P Z 0S0S V 00SG 0 0G @- p-@P0`/嚈1@S 1C/P X 0S0S@- p - M@ 0P`/p1S 1`C/PVw 0S0Sr0 Rb0 GR P`U* GRy73 wp`P|_`0! ᆇ`1S1PCP 0/!0!R U: 0 R Z劇P`/1S 1`C/PV 0S 00 00000G @@@@G 0H@- p -M@P`P_00000 0O00` 0:0 Sp 0C *00:   0 R$ `0 S到 _ 0:0```SL ` 0@ *00:   0 R Z  Z0 S QCp% P9 0 S 0 SJZ0 00S0@@0@0@ @00(1S$3G G ` 0:  C0:PP PG ZxZ00 S 0 S 00 R  R00 R  R C/@-p\  ^9 @@ P@T Q*:Q' \ \ @ T @ T  \ \ \ \a/ᰀ㰀  Z@- p00 0- 0 #00CR P P  \ \ P P P P R 　0  0　Z@-p@]㐀/0000/@- p0S 0S 000倀w 0  Ņ묅0@- pP 0 R 　!0P0က@- p0S00 S 0圅냅00倀0Q 00000000//@-p 0 C t00(1@S `1 0S D00(1S啅ᓅ됀萀 1包ኅ됀xZ0Q 00000000//@- p0S 4@- p0S0,4#က)@- p00S　 P@-p@݅吀@- p݅뀀0@S://`P@- p-M@PɅp @PU @@\@PP00\ P PP PP PPPPG4P `V SP(QU @@ @G`U`U r130@ 0#gP tC@00处<@@PGPUPPPUP&P<U RPPPEU*P"?1GP,G\P0S 0 !RZ00 w\0 0Z0  S\  0!0&0`S`VF0  0 X,Z0S ,|,810p0Sy 10S1 00 0T\0 Y00(1Sb 00S @0ӄ0@0S0Gp 0 @@ @GPP P0Gm 4044DbxZp Z` P0` 0@- p -@P`0S( V P 0 F@焠 Z pNXZp 0S 0S Z@-p@Q 00hP P `00lP 㐀 ,0000參v0P0᐀@0xZ@-p@ᡃ 0S圃ᚃ㐀 , 0  nUP0@-p00P @  &P@尀谀Db@- pMQ $"( S     0000Рက$00Рက@- p0S0<0,4#80က@- p -Mp20 "Qx F/G8!400,(!$  D"  $" R  ," R  H"00(20@2~?G82001p2 C<I4P= 420P2p"S7*420!S 0/SM 0<2PBP@("PR@$" "@[4B@-TW4B -RS420p"S * -R >R# -R  -RP<PBp2T P@ \-\@ Ppb^ >^ -^ 00@@P pR\* >\ -\ 0@@@@-T0P p2P P"pBR 4B@  pR^ B ^PDtlh@ !R  P 0 N=^ ^ P^ ^&  00P2 ,^ ^ "^ '^  P -^ P" >^ ! C ]R =R /R >R P x P s-^u !C]^v=^s /^ >^ P ^00P2 Y@"T @'Tb@@PB  @LPU P C00P2 > 0SP00P2  40-SN00P2  + -R P #00P2  -^ P 00P2 0-S100P2   -R]00P2  R(*RpBP 4B@p2T*0<200 pR*P =R!B ]\>R /R  !Sv``p2V*80 0@0>S <2SL,2E00 B Р  ᫁00 0 LP@\BL0\2NG 0T2X20 p P~*@/P@@pTo*0@@p Pe*x@0>S00@0>S, 0 ``0 p\E*`=^ PP!N]X>^ /^ ,Pv 0 pR^'* P煀ဦ帀@0 =S!E ]Z  >S 0/S W 0/S 0=S 0>SL 00l2P0d2tBhB` 000p"S* 00  pRQ*`PtRPşP@P"U P'U-  h"pRR*0 P Q  Q  pRQ*  pRQ*P Q >Q0`S`p2V*D20# \2: 0d2lb H27`2C00 B Р  ៀ0 00 РP$lb0PPp"U* P @ >RS `dbtbhb`lR\2lb 0РX20@"R@刀X@2X 002SW0@"8X0028@82T"010NG0 `"0A@ h d2tB@@F @TB@TBXB@XBlb\2 812<22X22S08"880 XS82 2422@BG 2/p2Ta:,1S 8(181$141001,102STG 0 pBR*@0 P  P  ,@1@@q! ,01$$j& ,1|cA ,0u\0PPs@`Po lPdtBhB`@0*a0d2lb8@H8[W8@WT8rG P  P pBP*@0 Z@- p -M 0Q*700@0@0P @ @P0D0 0  R6  ``VR 0 0S 0V0A0`U*V0@00 0`0`U*00 `U*00&SX D0#SM0 xR 0 / @ @P  0A\: 0 - 00  VP7AP *P   0   J0J Z*0R{ P{*p Z 3Z%:tAlC ;\0 Z.  ' g0C0 0;S" Z  $ 000 Z: ~P 0;S Z d$ 000  Z3Z2: <~P 0;S Z $ 000  u~P0;S Z # 000 _00U*0;SPU*.00P:00 00F S0F 00 RPPUR 0 0SU@09~0@0 0P00 0 00\ Ku @@TR 0 0SmU`0~0`0 0@00  ~00 0 00 RV@@TR 0 0SNUP0}0P0 0@00 0 00 00  R 0X!   RG 0M V`hbP~ ,0\}C}Pm]U0!z@0TU0@0KU000PU=*f<00P6*+>00P1*&&00P,*!"00P'*ZZp0Z@- p-0M@P`[X 20(1S  ~)0 00$0 00" UPP@0200SbRl20P`X20 P U(20xPU 0S 20;0S10t0S ,P10t0S 10^ R 0S1P  `1PX\P\H\@\8\41P10 \Z000 P 0\00 0 X(1S  (V 00P[ GD|~|00 (G|[ G@xZZ PZ[T;@- p -M00h1@ P R    0R:000sC 0S=0S: 0!## 0`00 0  00S$ 0 #*0 y|P 0P 0     0 00[ 0S 0`   SG ^/0{{[ 0@- pM@P h`V 0P 0 00P {PS G GM G0@-pM@P @>P 0dP 000GⰀGⰀ@- p-M@P $P 0JPU `V @|{P VG`F$@T @{P 0{P000G00@@- p - M@PTP T` `T{P T`%`0 {P"㚋(P {P Pc B@PP@ @P `V$0@DRP``P Tg@P;UFP``0P" 0P@<20`UV7`` 20`RV0``20`LV)``=V%`00! 0@ P0 `  0@ 0P P @`@@G `T)G @0@G zP$ '{PP@0@@T @ `V {0%P0 P`{P@T$@T zP 0S ,zP P EHzP j&` 4PZZ`p@- p -M@P `T zP@T @㚄$G  TG @ @PE$G @- p -M@P`,HZcZ``(Z L &Xy NP RP(QUG  &G ?zG 9z 10(1S ~& Q0 000000000 !" B  !"  X0X /R=0000S;G G K00(1S  0=& cNZ@@(AT  .& yG L0E&G 0000S 0G xZ P@-p@PP00*P 0 /ᰀB ,0ygyZ0@- p -M@6XP| X20(1S 0 @%0P0`Ux* F yP  U: Uq*10 0@ P U:  Q0  @ 0RU5 tQP@10P JFy P M[  G 0%5yZ'* P/y PP PPPPPPPPPPU Z* Pxy0L %G @@XXG @xZZ@- p000P x00P x뀀耀ZZ@- pMP00\  0 rРကY ,0xxZ0@- p-@Q@P`QZiU zk20(1S %xPTxP Z 0yPV@xT9Hx@@0FSPx  PBy@PT@*40 yPU*0yP 0FS EP@xPTT00(1S l0ll*xx `0TT$x x@:x @0  xw0$00xZP `bp@- p@P ixP `0:S`f@T] @10 0U 0  "0 BL0-QC:  4 0  "0 B0``0/S000  p00 0 0  #00C< 0 0Z@-p@x0P00㐀p@-p@P;wP wP <00 r0@ PO㰀Z@-p@wP吀㐀@- p0T 0P 0L0P 04 0000(1S 0#뀀耀`dhxZl@-p0@S QwP MwP Iw0000吀0000吀@- p0M@$@Q` wPX x10 0@ \10 0@0,B,*RC +R -R GR< MR TR +R 0-S000 0) wp  @@D @wwp N@ w@P Plwp PPEPewp H@@DP G@` G @T G\Z@- p -M@P v`v`00 BРT 0v0 8  @LРS:PlFlk蠟Fl`0`R`K K\PP00# G@Q>0G@QJ>0RF-@TA x>PU8 X>APD>-u90(1S $> !>P !A0.0-0-0=P 0-0t90(1S =! G@1P G  G@P @ G@嘶 G@P ҷGX፶h GXPt=P  0SG  G@P9X G@GX!@P0 ' `!? GXt(PL GX/!G  G@ 0F! <0GX1G(P pGX! Gp dPo PPj (G\ G,@Tf t 0CGdР t G:-  G`! GPQ [U 0CGlР G  Gltx8ATA ` @t  0CGhР4 |t GP( GP, GP@GPG0 M'0 R@0 RPQ P @T ,wG A @GA@ GPBGpPGtGx 8ttP  , GtGxV@ gtP+ GtGxI@ Gpt G MGb MtP;KG|KKP CGG`GHKG@s  G,tP s` G 0S " 0=S  0S  0 "R 0S 0"S  Ga`V `"V`P P s K GP P s P s P s G| Gps G P  GG@P GPH GP =P  G@GT =P GP1  G@T7 GA@P"U3 GA@P00PS 0"SP GPGQP P,U  GQP GQGAG GP ,P GP  GG GP @P@P 70S Gt1S Gp1S G\1S Gx1S#rtP r\P& r G| Gpr G ^ @ GA<|@xZ0pp% @@DР% Gtr Gt %Po %r % % Gxr Gx %8G%h0G8 G ϟ!   0PPHPGv% G\r G\ r% n% Gpr Gp f%8Gl%G80G0 x"" 000PUPxPGM% `hG L%$  F% vr  >%  :%G 6%8G<%G8@G@0-#20@@@PUG GtTr@PrPpLr` GpHrTP Br@@@I@(0 M G  GpLGt!%r ЍP&r`U&  r ?rrr"0 r 0 0  G| Gpq G 'ꈂ   G| Gpq G  G,@0`dhl@ G| Gpq G  @P P  G4! G81P Q /G GPGP1 P?U  GP eR 0CGР GP  Gq`P GP10GP! GPM\=ЍGH0P0P% !RZ uqG<)R'IGGR0 0 G`0 Gh G, GG\!G1o@Ѝ (P p Go G Go G GHo Go G@@o T)  GX$P=`=0Q$ t (P  G@=0P  GG0!R G<1S  G@P  GXG<1X>0(1S @ P&n0o  GP ; GXo(P GX| P7 GX1S17G @G0!@ GG1 G@GX@+ G@P# GG  GB@ G@P P @`P`@G BGB@P`G G@kpG  GB@ G@P PP`@G BGB@G10S0  GnP nT n GP : GXznD(P GX P GXAT G PtAn{n  GnP nT ~n GP H: GXCnh (P GX P{ GXATuMM P M (Pc  !G   $P  GQn F@ G jn PPP GV  nnPd  0 0   0@ P .RGSE =0 0 p=000R00 -0 S*$=0 0# =00 <00 >P $>(PP||>P p尠TGX10<><[0>L(P GX G2SP P k G: GP ^7 GXYk(P GXh  X GXAT8M@M< P $M<(P GL  @ kPP兀@  kPP兀@  kPlP兀@v tkP0@P@`^ @ GLA GA GDAxPxZP k G@cP GG1KG20G"KR03 ,GQ G"KR PS# GP6  G ?R0R N GP 6 GXj(P GX  | GXQU\ZdZ` P HZ(PWP jTtjG ZP ` jP  jP  GG1T`P9  G4  G0`.kZ  jP%  jP yjEBG100 G0.0 0h0000m00l00t00 G G1(P  GPS܀xP PNPgG∁ P GGQP "jT j GP 5 GXi(P GX\Pl GXATfNNP KN(PT <)G 0 G(PC  G0 xLP iT i GP 5 GXi (P GX P# GXATMM P Mh (P  l l (G G∁ P d @P GG 2P0G"R0 (0?P {iT wi GP A5 GXC :P#PP h G D GQ T h GP 4 GXh (P GX P+ GXAT%II P |I` (P d d *G AZ0D `Vp G074P  G0 0 G0Ga`9VohPl$h^h0 G0  GP 24 GX-h<(P DGX$ GXQUWWP W(P TT .hG 0`ldh` GPP|XV qhch chXh`$P  0g G0Mp G@ G  G GXG!,ЍG1 P< G e GP 3 GXg(P GX OGX1SI55P 5x(PB ||TP3 = GP j3 GXeg(P $GX GX1S44P 4(PP bgp XP gpG1 T G 0*sG @G\G\Gd0GlMg 0CGhРAg@g `sG GA GQ#Gn0 _GeG|0 G1 G1$,>PYk}7 !ꈂ\\-HP n/P2  ff ,82ff GLc f5G f5G  GG1P  GG1D`PT )g(e/bG Y*[P f G 0*sG 0@GA@@ GA GAT8 G3P GG<1000(1S 00P xZ0`dhl` @P 0@0@ZZ@- p -M @0PP ?00S?0?0Q ?0Sd?0O0/00 0 1*EfP 3`U`U 0S (P^PPU ^PP 5v PG(P^PPU(PP0,0(0`e 00 0B0d>0@0S ?P (P 4PPP(PCP PPPP"=e"G =0,1S? =001SB (0 e.0 0rigoGeP+ (GeP(X! 刀嘀 XXG 帀G0`0S0010S1`J,>p<00S  8 G$~eVG NeM0G( 0Ѝ 7eT0X0*  PV吀X T>P G~eP[WZ UPPPPP0PP[PPU PPU P0PPVP[PPUPPPXG  P0ZPPU ZPPPPPXG  P0xZPPU(PP=HP <0 XH[z0 L44XL̑HP dDP d@PH d@H@D@@@P6 FXZ0HSY ̐̐44L@44LL4LHP dDP }d@P ydHD@V+X`@H@D@@@P cdG  dGd0(@ HP OdDP Kd@P@H@D@@@P @dG pn HP 2dDP .d@P@H@D@@@P #dG HP$< HP dDP d@P d@H@D@@@P%@H@D@@@P c%G cDP c@P c@H@D@@@Po@H@D@@@P cG HP cDP c@P@H@D@@@P c"G 1O@@T  6@ #c<0@@M@ Ѝ HP cDP c@P@H@D@@@P c%G > ,,X/ DX, X3x 荟TXTX0S L Rx SXPP t=00SDP pL X ```D`V} xz ` X` XPTx  X HP *cDP &c@P`H`D`@`Pf c"G -p HP cDP c@P c`H`D`@`l``V `````z`H`D`@`k``V````` HP bDP b@P b`H`D`@`Tk``V `H`D`@`,k``V HP bV b@P b`H`D`@`j``V `H`D`@`j``V (P ;pTX < @0tP b"G PX0C07)T0X Rd MP  0 Ѝ 0XT Md Ѝ☉101崉 X` ?  RHP ObDP Kb@P GbHD@开X HD@开X xZZ1HP .bDP *b@PHD@开Xj b"G 艂@sLQ$*`0 MP X 0uЍ 0X M`, j Ѝ䇟101 X` ?  HP aDP a@P aHD@开X HD@开X pūHP aDP a@PxHD@开X a"G R.M  0Ѝ┆(HP aDP a@P aHD@@X"HD@X pZ^ MP  0 Ѝ 0XT Md Ѝ␅101嬅 X` ?  PHP MaDP Ia@P EaHD@开X HD@开X 0HP -aDP )a@PHD@开Xi a"G - 0 ЍL'HP aDP a@P aHD@X {HD@ЃX q``0*.X0M0 0O Ѝx'HP `DP `@P `HD@$X\ FHD@XR <X0T  M 0 0 Ѝⴂ'HP `DP `@P `HD@`X+ HD@8X! HD@d'X X,G (PQPPU x` P V*&X `J`HD@开X !A`HD@开X 7`HD@开Xz PPPS*`@H@D@@@P !`@H@D@@@P `@H@D@@@PZ G`@H@D@@@P s``H`D`@`PH xZ` ` P`Z@p@- p0P 4뀀耀h@- p<}`P`|`P P P　7뀀@-p0@S 71?㐀?00㐀@-pM0 oPoPp@n^^M 1^ y^4@e^@s^^8 1^^2 ,f\f\\% 0\ n\o\\ 0PP H <4}_G␀00G␀0ZZZ@- pM@P`R_P 0  A,0 B0SXS  G000 P$000C_ GZZZP@-p@PP _6㰀6㰀@- p-M@P` _0S 000 BS020R0@0Su " q gR^lRcmR sR wR "Q(QNN|t QdXPU;*0 !  @U*0  @ 0U:U  P  0@^GdRQthRQT400 P(00 0^GZZZZ @@u"A@-p@H@b^P 00R  /\ 㐀@- p<000 P $000 R4　　xZ@- pM@P`P D`` P8``00=^ G] GZZ@- p-@PP ^000#.0~S+0/S(`V$ ^P  C@P 0 S/R 0/S ]05 ^/00 0]5节@- pM0@S 5PU ` ]P0@ /R  `V X=Ѝ<00Ѝ@- pM0@PS[10PX|10@@ G0 :RR :P <  @ S 0  ]PPPPU00 @@@0}] Gc]``]0,5|0PS]T]0    0   G00]00@@ GxZZZZ@- p<00R/fP $00H1S00 D!倀耀xZ@- pM SP 0S |00  40S `00, , D!РကРက$000, , D!РကxZ@- p@P`0]P@@ p@- pMM0@P`s S~ <\P~ ,20 2X0Su 0 oS oS100nS0Sm 01S 0yS100eS100sS0SX 01S0SR 0"T10 0fS<10 0fS0SB 00S 0nS10 0oS0S3 00S0S- \P* 0-S00 01S0S PP @|@@t0p\GЍGЍ@@GЍ@@@ZZZ@-pM@PP 00P 4t00GⰀP00 PDPP<03\GⰀ\3PPGⰀZZxZ@- pM@P`P D`` P8``00\ G\ GZZ@- p\00 P D000S 00040S000倀　xZ@- p -M@P810a堁,[P[J [ [ [- [P# [ [# [P [ [P`0S q[P ``00堁aG @`` P4PP,0[G xZ0@PZZ`@- pM YP 400   РကРကxZ@-pM0@PS [P L00 @@@@80[[GⰀ 3008GⰀZZxZ@- pMc@P`0À 0H U[P@HUЍPPU\@- p -M@  $0[0S PP 0S P20 0@`V 00CSz`" S @0S 0#SG 00 ( R* _R -R Q0 R*`@RH  =RE ,P* @(0@C0 J Р  Z000ZS) 0 -\$ _^! 00Q00 Tp $0(2 0,20G ` \Z@- p-M@NZPUU 0!08PF `0 =@ZZ, Z4dXM* 0d!#( /P$ `(0LZ #Z!Za8P ` ZZV8P 00 `000.ZG8P0| 0YGYYHPP Z@T 0S 2P- 1P@PTPT, Y K1` YzYV 2PrY`V @VYP  eY00 x00p0YY``D00 <00<0sYJYxZ @ZZ0@@-p@PdP * 0L ## /P /0YXX0 0\@-p M@ 0P P@dT* 0 #$ /P YYG␀\00 T00L0YXG␀/0XXX0 0\ZZ@- p -M @P\*P62 0P0`P t ; V 71X 0 Q`{wtsdox>0pihheX\aHP]8DY >00S$OKGC?;7t3O@RLM@RO@X@PK 0R p0R/ ,\0R ,H0RY ,40Ru + 0RV , 0R ,0R%.0R ,0R8 0RG $>:62t.h*\&P"D8M@$.R SS SG Ht 8h (  ,;0 ;0 :0 :0 :0p ~:0\ x:0H r:0ll:0fT:0`<:0Z$:0T :0N90H90B90<906900|90*d90$L90}490w90q90k 80e80_80Y80S80Mt80G\80AD80;?05o`/`?0(?0"?0p?05\?0D?0t ,?0`?0L>08>00S bR)jR cR dR$0S oR%pR rR vRpp0Sv P\0Sn $$0Sg N@TPP Q8PG =0O=0 I=0 C=0 =p=0 7X=0 1@=0 +(=0 %=0t ~<0` x<0L rL@ P eQ PG l`00`M00,<MQЍ0S h(Ll,\t @\X|p(D8h 4DTd(@Xtp0H`xHX 8P90,0S90 , 90d1S 900S 90  , 40S|90 0 l900sX90 R<900S (900S90,1S 90@0S800DS80L0S 800S >+0( AAРR 80X(ZP`Z` X800ZP70D' 000Z0 17PHt(1S 070'70P 0-S0Su T7P0d'dS#OP |OxGOP7W: S70 OPc PgOO O6O0S P`|``f``V; `P6  Tf`\aVY <"`b`PZ Z0p `PP P `   @0pM`G`0 G|GЍ\e`\aV `|'P 450(1S L| @|NP KNN `P N|P N0S40LP d`P Gd`0Sp40L X400S X <40L0S3 d40 00S, H404P/ ' M 0Ѝ1 R # P # S ࠣS\^. X30Q 30P P,30@1S 30\1S sXPNPU="VG 040SiHR0S_ pkR0ST HNA@MG NtA@MG 00@@@QPMXM NtMG  P`p|10! X uNPppN mN`QiN&PU PA@HNG ^Xtyp 00  Z6"@ZZ`Z Z0`p  @@P  QxZpZ0@0,Z@0@pZZ@-p@P T LDM됀8(M됀  M됀, \/@- pM뀀@- p0 M뀀@- p0M뀀@- p -M˟|0 \C :0S@:0 0*0T M 00 0B0Р: LLxGIMPrhLP +P 0000@@00LLJ@ MJ@0LЍI@00G 0 S S  000@P0" R00c00S0P`^^ 8⋰Ỡ@K 0"S 0#SE  P#0P0S0S 000SA0Pᔈ@\QP000S6 0S1 0 0S* 00PQPQ0PQ0 0S0SP0"S 0\S0000S 0000CSL ,TR #0SGW0T0T XF 0 0#0 0000#0S @@)@@7#@0 0000#0S(TT60TD60 T4600S#0S 50 M0000500KЍ000 KP KP60T0T( `VKKK000 00 R0 L  P0 0 0E#0 0000@@*;#0 0000@!SKP NKP IKP lDKP D40 M`00,40H0qKЍ000S0000S 0S:Kz)000P 0 S S PwP}@@K0T0T PU  "@ @@@@@K0S 0   0R 0 P    FR   FR]PP(>& EE @0P 0PU =E0,00԰ 0$ 8E 0 E ,0  0,oEsE @@@```V`U$  00F$  0!FX00P``Vt 0S sE @U 00F0E S-[0 B BU `BQ<P `0] 000 0`}0P =P`00V >P` 0 0 P 0 ("E @@ @000SPc$  0E$  0EX00PP0S0( S2 000S- 0 0$ DP`d 0E 0E[00P0S 3 # 0%?. 0B-)QY , 2$ DP`0( CHD 0HDP`0@D 0tD7D0$ 0 0T2#0%?.0@<"P+ ,0 ό 23010?<0B , R: #+QQ0 0SDWD@00 DR30S 0000  0S00G /0DC ,0CC -0CC`h P DD@> ,0``CC[ 0  U P 0d 0CD@@0 Pppap@ @ų@@?~0@@- p%-P 0D뀀D뀀@W00  *0/0s/00/@- p0S *(뀀*뀀@-p 0:0@PS0: 0:  P * P*P 0:0:PPP㰀0:000㰀@-p 0:0@S SPPQ 0:0 C 0:  B 0:   ᰀ㰀 0:  0 *0/@- p -TM@P0P00P @ @@@@0"00 0"0N#"000D080!10S8 80!R  31S S\P&0S# <00H @0L0P 70P! LϺP `70Lb D 870(1S L,0<0Ss G@Pn D#Pj @d@8@4@6P`@LH08@@4 D `<@TW D@TT @"TQ8@N L @400S? T9 L@0 0!PU? `V@ g `00 0jhB[[ 50(1S 0* L"LrB40L0T LUP, @Rr ,UPdQU R  PU  E@(AT P@T+ 000DL0 40 1S 00S  @`T`T LX   P`0V PU(40\1SDP' P$30(1S 30\1 $ S[30\1D SsDBP AA hDlLAHP ADP A0D0830!00S0S 00( $0, P,: @ 0008P `L@00200 0!PU 00( $0,P ,A(P A 00( $0,PA0s!10!1Qh S 003R R\PW 6G P0T G @@[ ,8188h>  \ *Pf`P-^ PP`^*0@X* R   :RD 60(1S 000 0 S @[@6"1   Z:0L0S@ 0S~ 0 S \>P. 0S$0S JZ*X  @@ @DT  l>P  @@$@@T  @@@ @X @@,@(@ @ @ 0SC 0S xL>P7$0S( [*0/S@ @00 X ڊZ0 000 㚋( @@@@@(@@(@,@ @@@@ @,@ @0S? x >P9$0S0 P [P [*0/S@ @00000 0 S ڂ0R00 0 000000 1# @P@@ @@ @@(@ @@ @@(@hB@(AT l@@@ @0Ti0=000Sd0@@ @ P@Q 0-P000SQ 00^  `00 PS800A=00@0G 0000  R.0G 0 0?`  [ 3[: `$ (D@@$@@ @(@< @ @0 0\\<<0  0000 0G 0 0T*Z0xZ 0@P@-p@PU <<0( H㰀@ᰀ@- p - MP @@T@@@0 R_  ^n P%U%RP`冀P  QP劰P  \E\@UQP`7`F \E\b@U[ڜQP P`7`FP/U  P%U%dQP`冀P  HQP劰P  \E\@UQP`7`F \E\b@U8PP P`7`FP/U  R R 0 #$@00(1S 0T 0G @ 0 R@G `0`F/Z `0`F/Z ZZxZ@- p-@P`2<000 B Р  I<:00 0q00S?h0`0 0ᠳP @ G 0 G@- pM@P;`000 BР <:000440P @GЍGЍ@- pMM@_ P``` 0y;"X`"X P ;00GЍGЍ@- p-@;P`U ;XV;z;x;@-p00P @  P坱@尀谀3@- p -PPPPl 0 @@(P@ P@0@T590(P00 0 1":D;I;4qP 0: 0:AP @1@A 0000 @@(0@ 0@0@T 0( 0d@T6 @@\0T4(p0@00S 0 h0S'4G 0(0@(T $g:$5:P @00 0I,@@@ @, @, @ h0  4G kPxZ  $@@,@p@- p -@P` 0:P_Td 09P7P`9@1 9 09P`  0: 0:[00P@0SB @ 0: 0p:[00P@0S2 @ 0l: 0Z:[00P@0S& 628900 # ,0L939I/0ttF9-900 629PP 629PP 0@@@-pM@000] 00$$T@A9G␀a 4@-pP @PP P 99U @가@- p0 P0E뀀@0@- p -M020@Sf 20Qa 08TP! T8 09  09[00PXF 1899G `10@Q 08P( 4100 S 0(-  08@P 0q8@P 0j89`00(1S9G G @|0@G Dy9G X0K8m9r9G 000!P$0e9G HxZ.AP@- p -`M@8P0045000 PBР `BРxG8P7W: S"004XH|  0Z8  0U8O8Z 00 I8C8G G xZ@- p -DMd(0$ ,\0@0@00,@$0S 0$ 0000(0S00000(0S 0( 08 PU 70<1 R  00 000 0 00 00<0404700S g`P ۳P`V V V f`Pv8P`@#f`P i8P |f`Pt_8P `X Qh Df+8@Va 8 @T8 0 7@T4@5E@ PQPQ4G PUA 0U>  ^|7@T PE@ PQPQ4G U= PUUP PU TP00 ՜P400* 4P 0SnP 000 0P @Ts |0 00 0 0G @@` $ `@(`T:00 00    @R s/+0//%@,  P( U* 0 0G @ PxZO0 P0@- pM8M0 0$0(0(60D@PT /`Vc Q Q$Q  (0  0(00(05000S 50<0S (0S 0$QJ Q Q$Q  /0( 0(00(0@/`(00$Q1 Q Q$Q s (0  /(00(00 #0 QC 401:@S+@(00$Q  Q Q$Q J (0 @(0@(@ q/`0$Q Q Q$Q 2 (0   /(00(0@308`//P4 @tc`8`/v/P) T V(0S 0$Q Q Q$Q  /0( 0(00(0 0d@/M/`FP(0S 0$Q Q Q$Q  /0( 0(00(0$@0H"S@. 0 8@Tk 0Sh T" 101?PS@P(00$Qp Q Q$Q  (0 P(00(0. 0  (00$QU Q Q$Q  0( 0(00(010@0 @S000S 00,1S0000S P P PU @GЍB@p.GЍ@cxZW@@- p -M@Pt/PY.PU.0E ?R #Q 6'G PE00` `. \.00  G #].P).P@00` C. ?.00  G /R/Rd  /R E/#.P 0/S P`E000Uz  .00G > ` E/.0V  P01/\k P 2h V ` `&`` 0\ `PF00s0VR  -00G /R PEUPUM `V`U:V`U/VH P`E00JU  -0@0&8  -0 0 G ZG  -  -00G ``` -  -00G 0P`PP` 0/  C k-0 0 G P@- p -$M0 #00000@P S +-00U %-0000P0SPT -0000 /+D3DD,,0(P  >0,P 0S 3@0P:"-`,,0V0    P0V000 0P PP0 00S 00 00S ,PPT ,PPx`, , 00# ,  ,T :, , @0000# [000,  , 00# ]0 0 00 0 S :000 0 0000CS  00(0 S Q,T 0S0,0SG 00)WUDS ,80((,+1,G W`P0@- p -@!, P iP P0, `%V# 2Z FZ/`` ``VPPP$ G`0S 0S+ (`PP00 R  ++ 0 ,/00 , 0   0S +$0S ++ + @-p@P$+$|밀@-p@P + p밀P QP 0P  Q0//@- p -HM<0DS 00LP+ +P @< 4$@T  R @0 QC %\-@\P , P l`P $ @ @P 7L @  @P 7@ ˟@  0  \0 Rv @C00@@@@,@@Tm ,@0 %RB B  ; AAQ࠳@QUڴ7A \E\`AU`@UKڄZP P7PEpZ75 . H* 7B & 0 B @T @0ɟ %ɟ     @R)  7 B @T@  R0, 0D@0T @0@9*<,@@(@D+P @@T@(0@D8@80<@@0@,@0004@[S0@,0@]*P ,@T ,@0T@@4+P4s*0@@,04@T @@8 4$@00:S@`@+PY*@@PP@V PV*@0' `  lFL0@D`0V:0/S0$0k+P$/*PP`0;S0 0`[+P *``0?S00#C*P*``V~PPPP`0#Sy0 0)```0Ss80Sw 0``F,<Xs (` J:*`(Vj Vl  ( ``0  )004 @(`,$@@0/S `)0 S@}@0) T8*`0.Q.Q,\ /^@T:`@a .\ P /PS C \Q/^ 0@T:`@@/Q@T:`@7S P3P!*/P @0T:`@P3P*/P@0 0@@0@0T:`@TT 00@/)`V 5 $ $@0S `20 0 c````0S @T @T   @T @(@V$0S T  ,0@S% ,( G ,0@Sp ,@@ G 0   S=@,@@,[ ,0 S ,(D[\ G 0Nh@,@,@0PL ,P1PPo(V(@8@ @@P_@]$PiPg t`r000`00 0 ,0H(/(``@`:@03J GE`\B G D@G WZZN0`P0`Z@- p)P 0@-p@Q00 0'Z@- pP )Pw)P @@- p)P P@- p)P 0S 0(   RPZ@- p0S 0  R0 Rက0@- p@P0d:)`V PE (000@- p -MPm 0Sj 00@P`X= ,X3P,U.P0P )PXr)P P0f([F J  '` `0`@``刀`@````PPU@0 P (P>(P P0f(X @D '00 !0G G @0Z@-pM'p<00G␀f' @>'G␀`@-pMt'p\00G␀L' 0@ @ ?; 0@'G␀p@-p M@ (p &&0 jG␀G␀@-p`M@ K'PPZ UlPP(QU \/&PUGⰀP&&0 ?GⰀxZ@- p(0#@- phM 'P0: SРကРက@-p@&@T  ''P&ᰀ㰀 @-p @QRu -00 b RwcR{R0'<R7R7R7R7RP7R73A>?00B'/00Cx'B/0d0CL'B/0 =0C'"&/0j0C&B/0q0C&B/00C&""/0d0Cl&"A!/0 0C00 00 0᐀,&&*&00000᐀5C?0 0B00000᐀5?0d0B%B/0 0C00000᐀h5C?00B@%/0d0C%B/0 0C00000᐀4C?0q0B$B/00C$/0d0Cl$B/0 0C00000᐀H4?0j0B$B/0q0C#B/00C#/0d0C#B/0 0C00000᐀|3C?0 =0BL#/0j0C#B/0q0C"B/00C"/0d0C"B/0 0C00000᐀2C?0t0B\"B/0 =0C,"/0j0C!B/0q0C!B/00C!/0d0C|!"A!/0 0C00000᐀t13|$P00 `BР $.@@@@P%PP%P @ GP@- p00H0S%@@H@%QQ $0$ #%0@P z%X p`u% q%@,$#00H##xZ  @ Zp @- pM@$0P `FР$0V@/S@0S 0/SP P@00@S 0/S`'%VPP:%U /0 00S 0/S@GЍ@- p-@P/T$`V?%Pp#0d0%X F #/0 00d0#eP00S 0  0R  R  \ 0S/0S 0,B,>R ?0C0 #S0S/0*S@-p0@Se eP0 S S( 0̠L̠>\l?AQgQ0  RA  0R]  R  Q 0S-?AQ5Q*0 /S 0Q 0\5 \  ^ 00000S) 0S尀P0S ̠L̠>\*Q bP*Q bP00@-p@ 0/SPd00dP  YP <00`P㰀 K0P0ᰀxZ@- pM@P`""V @P0\)0CQ\PX P@@H0 X  Q0C RQ0p0ЍZ@-p0@S P0S 0  @ >P? B R R P 0S㰀 *R bP@-p@="P@P 0/S0/S@@00\ PRPXP  P P \ P ᰀ㰀0P0ᰀxZ@-p@"P@P 0.0C0S0.S 㐀0␀@-p@T \"P L"P 0S㐀"0P0᐀  @- pM@R#PU? R "P; R`!X 00S S `U #P+ P"P% PF "PX !PQ U "P P"P PЍ4CR`$>j!Ѝ60@@- pMtM0-S 0S2!P@"P{@P "`Vy !P<P0 "p Th @@GЍ00 "Pd 000/S刀P "Pu"P  H P0T0P$0# Q QP j"PR"P 00GЍ00GЍ0#  GЍGЍ\ @@GЍ0  GЍZ0@@-p0@S " 됀  됀@-p@P 0S P 0S 밀谀@- pM0P0@PP= T: RR y Ѝ ``P R` !%  Q !P\(!P P0! J Ѝ@Ѝ@@- p@P!`V !P 00T 0 R 0 R`0P@- p@Px!`V !P 0PP 0 0R 0/@-p@P PP PU㰀@-pP @!U @가@-p@PᮗPZ!Q  ̗밀谀P @- pᛗ뀀@- p　@-p@ U됀P@-p@㐀@- p D뀀茣@-p0@-S-0!0@0#000@S00   0#000@S"ڐ  R0Q dώ @\^ ,\ 吀 0VUUU@-p$M @G␀@-p8M0@  G␀ PP0#C!/0` S 00, B/ P/00ꙙgfff@- p} P 0@- p뀀@-p@Pg PPPP尀@-pd @T PW PP0PPᰀ0@- p -M00C 00  BA 0P`00 B 0 0 0 @P`  0  0[00P   0S P`P PPPG `G @@/ᚙ?@-p0@S@PS 0  @ ;P "P &P0Q <P >P 0Q  0Q Q00QPZ Z0 A;Q Q8 "Q% &QC& a  m  p  ;   0R9 <Q >Q0& g<Rlt  ;   0R% P& q  u  o  t  ;   0R& #  3  2  ;   0R  R 尀000@- pMH00H0S 800A (IPРကРကxZZht@@- p\00@S[08 0BP` 0>4 z@- p -|10S?0\!0&l@L1 k>4 ha@(10S*0!0WP0 V>4 SLP00S0 0B`㤀 0@>4 =684 0j@-X0 c 0@P40  W 0v @@.AeA@- pP,뀀 , 0  &   0@- p - M@P` 0XP: P9  00  0S /@    @ G /G G .A__dyld_make_delayed_module_initializer_calls__dyld_mod_term_funcsUnable to convert `%s' to a bind address. Reverting to ANY. %s:%u: failed assertion `%s' connect.cconnection_host_name == NULLconnection_host_name != NULLConnecting to %s[%s]:%hu... Connecting to %s:%hu... Closing fd %d connected. Created socket %d. failed: %s. Master socket fd %d bound. using port %i. Created socket fd %d. orig.origCannot back up %s as %s: %s %d; URL=%sconvert.cto - newname == fsqlen/index.htmlfile != NULLApparently %s has been removed. Scanning %s (from %s) will convert url %s to local %s will convert url %s to complete Converting %s... nothing to do. Cannot convert links in %s: %s Unable to delete `%s': %s wbSomething strange is going on. Please investigate.Skipping %s at position %d. *s1 != '/'../TO_RELATIVE: %s to %s at position %d in %s. TO_COMPLETE: to %s at position %d in %s. %d-%d Converted %d files in %.2f seconds. Deleted old cookie (to be replaced.) permanentnonpermanent (ANY) Stored cookie %s %d%s %s %s %d %s %s %s cookies.cname_b != NULL && name_e != NULLdomainpathexpiresmax-age%lfsecureError in Set-Cookie, field `%s'Syntax error in Set-Cookie: %s at position %d. cdm: 1 2 3 4 5 6.com.edu.net.org.gov.mil.int 7 8Cookie coming from %s attempted to set domain to %s Attempt to fake the path: %s, %s res != 0Discarded old cookie. ocnt == countCookie: pos == result_sizerCannot open cookies file `%s': %s TRUE:%dFALSE %s %s %s %.0f %s %s Saving cookies to %s. w# HTTP cookie file. # Generated by Wget on %s. # Edit at your own risk. Error writing to `%s': %s Error closing `%s': %s Done saving cookies. byteftp.ccon != NULLcon->target != NULL!((cmd & DO_LIST) && (cmd & DO_RETR))(cmd & (DO_LIST | DO_CWD | DO_RETR | DO_LOGIN)) != 0user && passwd%s@%sLogging in as %s ... Error in server response, closing control connection. Error in server greeting. Write failed, closing control connection. The server refuses login. Login incorrect. Logged in! ==> SYST ... Server error, can't determine system type. done. ==> PWD ... /Initial VMS directory not in the form [...]! Preprocessing the initial VMS directory old = '%s' new = '%s' done. ==> TYPE %c ... Unknown type `%c', closing control connection. done. ==> CWD not needed. changing working directory Prepended initial PWD to relative path: pwd: '%s' old: '%s' new: '%s' *ntarget == '/'Changed file name to VMS syntax: Unix: '%s' VMS: '%s' ==> CWD %s ... No such directory `%s'. ==> CWD not required. ==> SIZE %s ... ==> PASV ... Cannot initiate PASV transfer. Cannot parse PASV response. couldn't connect to %s:%hu: %s ==> PORT ... socket: %s Bind error (%s). Invalid PORT. ==> REST %ld ... REST failed; will not truncate `%s'. REST failed, starting from scratch. ==> RETR %s ... No such file `%s'. ==> LIST ... No such file or directory `%s'. .Lying FTP server found, adjusting. accept: %s ab%s: %s Length: %s [%s to go] (unauthoritative) %s: %s, closing control connection. %s (%s) - Data connection: %s; %s (%s) - Control connection closed. Data transfer aborted. %s File `%s' already there, not retrieving. (try:%2d)--%s-- %s %s => `%s' %s (%s) - `%s' saved [%ld] %s URL: %s [%ld] -> "%s" [%d] Removing file due to --delete-after in ftp_loop_internal(): Removing %s. unlink: %s .listingUsing `%s' as listing tmp file. Removed `%s'. Rejecting `%s'. No matches on pattern `%s'. %s%s%s/%sComposing new CWD relative to the initial directory. odir = '%s' f->name = '%s' newdir = '%s' Not descending to `%s' as it is excluded/not-included. Recursion depth %d exceeded max. depth %d. f != NULLRemote file no newer than local file `%s' -- not retrieving. Remote file is newer than local file `%s' -- retrieving. The sizes do not match (local %ld) -- retrieving. Invalid name of the symlink, skipping. Already have correct symlink %s -> %s Creating symlink %s -> %s symlink: %s Skipping directory `%s'. %s: unknown/unsupported file type. %s: corrupt time-stamp. Unrecognized permissions for %s. Will not retrieve dirs since depth is %d (max %d). Wrote HTML-ized index to `%s' [%ld]. Wrote HTML-ized index to `%s'. %s%s%s PASS--> %s --> PASS Turtle Power! --> %s USER331 s/key 331 opiekey %d,%d,%d,%d,%d,%dPORTPASVTYPECWDRESTRETRLISTSYSTVMSUNIXWINDOWS_NTWINDOWS2000MACOSOS/400PWD"SIZEtype=JanFebMarAprMayJunJulAugSepOctNovDecrbtotalPLAINFILE; DIRECTORY; SYMLINK; UNKNOWN; implicit perms %0o; perms %0o; month: %s; day: %d; year: %d (no tm); time: %02d:%02d:%02d (no yr); -> link to: %s .. Ignoring `.' and `..'; trailing `/' on dir. trailing `@' on link. trailing `*' on exec. Skipping. Name: '%s' -:MYYYY/MM/DD HH:MM - %d/%02d/%02d %02d:%02d Timestamp: %ld Directory File, size %ld bytes JANFEBMARAPRMAYJUNJULAUGSEPOCTNOVDECfile name: '%s' .DIRFile Getting additional line empty line read, leaving listing parser confusing VMS listing item, leaving listing parser second token: '%s' day: '%s' nonsense in VMS listing, skipping this line date parsed YYYY/MM/DD HH:MM:SS - %d/%02d/%02d %02d:%02d:%02d ,)confusing VMS permissions, skipping line wrong VMS permissons! permissions: %s -> 0%o Unsupported listing type, trying Unix listing parser. %s%s%s@ �����������Index of /%s on %s:%d����������� 

  %d %s %02d %02d:%02d         time unknown       File        Directory   Link        Not sure    %s  (%s bytes)(nil)-> %s
store is `%s' host.cindex >= al->faulty && index < al->countindex == al->faultyReleasing %p (new refcount %d). Deleting unused %p. Host not foundUnknown errorFound %s in host_name_addresses_map (%p) Resolving %s... failed: timed out. count > 0%s, , ...Caching %s => %su->host != NULLal->refcount == 1ampquotnbsphtml-parse.cto - (pool->contents + pool->tail) <= end - begch == '\'' || ch == 0x22ch == quote_charch == '-'hrefcodesrcbackgroundlowsrcrelhttp-equivnamecontentactionaappletareabasebgsoundbodyembedfigformframeiframeimginputlayerlinkmetaoverlayscripttabletdth%s: no base, merge will use "%s". %s: Cannot resolve incomplete link %s. %s: link "%s" doesn't parse. %s: merge("%s", "%s") -> %s %s: merged link "%s" doesn't parse. appending "%s" to urlpos. html-url.cfirst != -1stylesheetshortcut iconrefreshrobotsnonenofollowt != NULLLoaded %s (size %ld). no-follow in %s: %d %s: Invalid URL %s: %s http.csock > -1 || ssl != NULLsock == -1 || ssl == NULL[writing POST file %s ... written == promised_sizedone] bytesKeep-Alivewget_cookie_jar != NULLInvalidating fd %d from further reuse. %a, %d %b %Y %T%A, %d-%b-%y %T%a, %d-%b-%Y %T%a %b %d %T %Y%s:%s%s: Basic %s 0123456789abcdefrealmopaquenonceAuthorization: Digest username="%s", realm="%s", nonce="%s", uri="%s", response="%s", opaque=" Failed to set up an SSL context Failed to load certificates from %s Trying without the specified certificate Failed to get certificate key from %s *hs->local_file != NULLUnable to establish SSL connection. Reusing connection to %s:%hu. Reusing fd %d. HEADPOSTGETReferer: %s Pragma: no-cache Range: bytes=%ld- Wget/%sAuthorizationBasicNTLMDigestProxy-AuthorizationConnection: Keep-Alive Content-Type: application/x-www-form-urlencoded POST data file missing: %s Content-Length: %ld ][%s %s HTTP/1.0 User-Agent: %s Host: %s%s%s%s Accept: %s %s%s%s%s%s%s%s%s%s%s */*---request begin--- %s[POST data: %s] ---request end--- Failed writing HTTP request: %s. ProxyHTTP%s request sent, awaiting response... End of file while parsing headers. Read error (%s) in headers. HTTP/No data receivedMalformed status line(no description) %2d %s%2d %sContent-LengthContent-TypeLocationLast-ModifiedSet-CookieWWW-AuthenticateAccept-RangesContent-RangeConnectioninhibit_keep_alive == 0pc_last_host_ip == NULLpc_last_host_ip != NULLRegistered fd %d for persistent reuse. Authorization failed. Unknown authentication scheme. [following]unspecifiedLocation: %s%s text/htmlapplication/xhtml+xml.htm.html The file is already fully retrieved; nothing to do. Continued download failed on this file, which conflicts with `-c'. Refusing to truncate existing file `%s'. Length: (%s to go)ignored [%s] Warning: wildcards not supported in HTTP. File `%s' already there, will not retrieve. Cannot write to `%s' (%s). ERROR: Redirection (%d) without location. %s: %s ERROR %d: %s. Last-modified header missing -- time-stamps turned off. Last-modified header invalid -- time-stamp ignored. Server file no newer than local file `%s' -- not retrieving. The sizes do not match (local %ld) -- retrieving. Remote file is newer, retrieving. %d %s %s (%s) - `%s' saved [%ld/%ld] %s URL:%s [%ld/%ld] -> "%s" [%d] %s URL:%s [%ld] -> "%s" [%d] %s (%s) - Connection closed at byte %ld. %s (%s) - `%s' saved [%ld/%ld]) %s (%s) - Connection closed at byte %ld/%ld. %s (%s) - Read error at byte %ld (%s).%s (%s) - Read error at byte %ld/%ld (%s). acceptaddhostdiralwaysrestbackupconvertedbackupsbindaddresscacheconnecttimeoutcontinueconvertlinkscookiescutdirsdebugdeleteafterdirprefixdirstructdnscachednstimeoutdomainsdotbytesdotsinlinedotspacingdotstyleegdfileexcludedirectoriesexcludedomainsfollowftpfollowtagsforcehtmlftpproxyglobheaderhtmlextensionhtmlifyhttpkeepalivehttppasswdhttpproxyhttpsproxyhttpuserignorelengthignoretagsincludedirectorieskilllongerlimitrateloadcookieslogfileloginmirrornetrcnoclobbernoparentnoproxynumtriesoutputdocumentpagerequisitespassiveftppasswdpostdatapostfileprogressproxypasswdproxyuserquietquotarandomwaitreadtimeoutreclevelrecursiverefererrejectrelativeonlyremovelistingrestrictfilenamesretrsymlinksretryconnrefusedsavecookiessaveheadersserverresponsespanhostsspidersslcadirsslcafilesslcertfilesslcertkeysslcerttypesslcheckcertsslprotocolstrictcommentstimeouttimestampingtriesuseproxyuseragentverbosewaitwaitretryHOMEinit.c0 <= comind && comind < countof (commands)%s: Cannot read %s (%s). %s: Error in %s at line %d. anonymous-wget@no_proxy/usr/local/etc/wgetrcWGETRC%s: WGETRC points to %s, which doesn't exist. %s/.wgetrc%s: Warning: Both system and user wgetrc point to `%s'. %s: Invalid --execute command `%s' %s: %s: Invalid boolean `%s', use `on' or `off'. alwaysnever%s: %s: Invalid boolean `%s', use always, on, off, or never. %s: %s: Invalid number `%s'. inf%s: %s: Invalid byte value `%s' %s: %s: Invalid time period `%s' %s: %s: Invalid progress type `%s'. %s: %s: Invalid header `%s'. unixwindowsnocontrol%s: %s: Invalid restriction `%s', use `unix' or `windows'. %s: %s: Invalid value `%s'. wget-log %s received, redirecting output to `%s'. %s: %s; disabling logging. Usage: %s [OPTION]... [URL]... backup-convertedconvert-linksdelete-afterdont-remove-listingfollow-ftpforce-directoriesforce-hierforce-htmlhelphtml-extensionignore-lengthno-clobberno-directoriesno-host-directoriesno-host-lookupno-http-keep-aliveno-parentnon-verbosepassive-ftppage-requisitesrandom-waitrelativeretr-symlinksretry-connrefusedsave-headersserver-responsespan-hostsstrict-commentsversionappend-outputbind-addressconnect-timeoutcut-dirsdns-timeoutdirectory-prefixdns-cachedot-styleexecuteexclude-directoriesexclude-domainsfollow-tagshttp-passwdhttp-userignore-tagsinclude-directoriesinput-filelevellimit-rateload-cookiesnooutput-documentoutput-filepost-datapost-fileproxyproxy-passwdproxy-userread-timeoutrestrict-file-namessave-cookiesuser-agentuse-proxyegd-fileonoffGNU Wget %s, a non-interactive network retriever. Mandatory arguments to long options are mandatory for short options too. Startup: -V, --version display the version of Wget and exit. -h, --help print this help. -b, --background go to background after startup. -e, --execute=COMMAND execute a `.wgetrc'-style command. Logging and input file: -o, --output-file=FILE log messages to FILE. -a, --append-output=FILE append messages to FILE. -d, --debug print debug output. -q, --quiet quiet (no output). -v, --verbose be verbose (this is the default). -nv, --non-verbose turn off verboseness, without being quiet. -i, --input-file=FILE download URLs found in FILE. -F, --force-html treat input file as HTML. -B, --base=URL prepends URL to relative links in -F -i file. Download: -t, --tries=NUMBER set number of retries to NUMBER (0 unlimits). --retry-connrefused retry even if connection is refused. -O --output-document=FILE write documents to FILE. -nc, --no-clobber don't clobber existing files or use .# suffixes. -c, --continue resume getting a partially-downloaded file. --progress=TYPE select progress gauge type. -N, --timestamping don't re-retrieve files unless newer than local. -S, --server-response print server response. --spider don't download anything. -T, --timeout=SECONDS set all timeout values to SECONDS. --dns-timeout=SECS set the DNS lookup timeout to SECS. --connect-timeout=SECS set the connect timeout to SECS. --read-timeout=SECS set the read timeout to SECS. -w, --wait=SECONDS wait SECONDS between retrievals. --waitretry=SECONDS wait 1...SECONDS between retries of a retrieval. --random-wait wait from 0...2*WAIT secs between retrievals. -Y, --proxy=on/off turn proxy on or off. -Q, --quota=NUMBER set retrieval quota to NUMBER. --bind-address=ADDRESS bind to ADDRESS (hostname or IP) on local host. --limit-rate=RATE limit download rate to RATE. --dns-cache=off disable caching DNS lookups. --restrict-file-names=OS restrict chars in file names to ones OS allows. Directories: -nd, --no-directories don't create directories. -x, --force-directories force creation of directories. -nH, --no-host-directories don't create host directories. -P, --directory-prefix=PREFIX save files to PREFIX/... --cut-dirs=NUMBER ignore NUMBER remote directory components. HTTP options: --http-user=USER set http user to USER. --http-passwd=PASS set http password to PASS. -C, --cache=on/off (dis)allow server-cached data (normally allowed). -E, --html-extension save all text/html documents with .html extension. --ignore-length ignore `Content-Length' header field. --header=STRING insert STRING among the headers. --proxy-user=USER set USER as proxy username. --proxy-passwd=PASS set PASS as proxy password. --referer=URL include `Referer: URL' header in HTTP request. -s, --save-headers save the HTTP headers to file. -U, --user-agent=AGENT identify as AGENT instead of Wget/VERSION. --no-http-keep-alive disable HTTP keep-alive (persistent connections). --cookies=off don't use cookies. --load-cookies=FILE load cookies from FILE before session. --save-cookies=FILE save cookies to FILE after session. --post-data=STRING use the POST method; send STRING as the data. --post-file=FILE use the POST method; send contents of FILE. HTTPS (SSL) options: --sslcertfile=FILE optional client certificate. --sslcertkey=KEYFILE optional keyfile for this certificate. --egd-file=FILE file name of the EGD socket. --sslcadir=DIR dir where hash list of CA's are stored. --sslcafile=FILE file with bundle of CA's --sslcerttype=0/1 Client-Cert type 0=PEM (default) / 1=ASN1 (DER) --sslcheckcert=0/1 Check the server cert agenst given CA --sslprotocol=0-3 choose SSL protocol; 0=automatic, 1=SSLv2 2=SSLv3 3=TLSv1 FTP options: -nr, --dont-remove-listing don't remove `.listing' files. -g, --glob=on/off turn file name globbing on or off. --passive-ftp use the "passive" transfer mode. --retr-symlinks when recursing, get linked-to files (not dirs). Recursive retrieval: -r, --recursive recursive download. -l, --level=NUMBER maximum recursion depth (inf or 0 for infinite). --delete-after delete files locally after downloading them. -k, --convert-links convert non-relative links to relative. -K, --backup-converted before converting file X, back up as X.orig. -m, --mirror shortcut option equivalent to -r -N -l inf -nr. -p, --page-requisites get all images, etc. needed to display HTML page. --strict-comments turn on strict (SGML) handling of HTML comments. Recursive accept/reject: -A, --accept=LIST comma-separated list of accepted extensions. -R, --reject=LIST comma-separated list of rejected extensions. -D, --domains=LIST comma-separated list of accepted domains. --exclude-domains=LIST comma-separated list of rejected domains. --follow-ftp follow FTP links from HTML documents. --follow-tags=LIST comma-separated list of followed HTML tags. -G, --ignore-tags=LIST comma-separated list of ignored HTML tags. -H, --span-hosts go to foreign hosts when recursive. -L, --relative follow relative links only. -I, --include-directories=LIST list of allowed directories. -X, --exclude-directories=LIST list of excluded directories. -np, --no-parent don't ascend to the parent directory. Mail bug reports and suggestions to . GNU Wget %s Copyright (C) 2003 Free Software Foundation, Inc.This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. Originally written by Hrvoje Niksic .%s: illegal option -- `-n%c' Try `%s --help' for more options. hpVqvdkKsxmNWrHSLcFbEY:G:g:T:U:O:l:n:i:o:a:t:D:A:R:P:B:e:Q:X:I:w:C:Can't be verbose and quiet at the same time.Can't timestamp and not clobber old files at the same time.%s: missing URL DEBUG output created by Wget %s on %s. darwin8.10.1Removing file due to --delete-after in main(): No URLs found in %s. FINISHED --%s-- Downloaded: %s bytes in %d files Download quota (%s bytes) EXCEEDED! SIGUSR1WTF?!SIGHUP.netrcpasswordmacdefaccount%s: %s:%d: warning: "%s" token appears before any machine name defaultmachine%s: %s:%d: unknown token "%s" dotbar %*s[ skipping %dK ] %5ldKprogress.cdp->dots < opt.dots_in_line%3d%% binarymegagigaInvalid dot style specification `%s'; leaving unchanged. percentage <= 100%2d%% 100% dlsz <= progress_sizeinsz <= dlsz %-11sB/sK/sM/sG/s %7.2f%s --.--K/s ETA %02d:%02d ETA %d:%02d:%02d p - bp->buffer <= bp->width TERMforceemacsEnqueuing %s at depth %d Queue count %d, maxcount %d. Dequeuing %s at depth %d Deciding whether to enqueue "%s". Already on the black list. Not following non-HTTP schemes. It doesn't really look like a relative link. The domain was not accepted. Going to "%s" would escape "%s" with no_parent on. %s (%s) is excluded/not-included. %s (%s) does not match acc/rej rules. This is not the same hostname as the parent's (%s and %s). Not following %s because robots.txt forbids it. Decided to load it. Decided NOT to load it. %s: %s. Already downloaded "%s", reusing it from "%s". recur.corig_parsed != NULLnew_parsed != NULLRedirection "%s" failed the test. Not descending further; at depth %d, max. %d. url_parsed != NULL--delete-afterrecursive rejection criteriaRemoving file due to %s in recursive_retrieve(): Removing %s since it should be rejected. res.c!EOL (p)Ignoring malformed line %dwgetallowdisallowIgnoring unknown field at line %dj == cntCannot open %s: %sAllowingRejecting%s path %s because of rule `%s'. /robots.txtLoading robots.txt; please ignore errors. deferring a %.2f ms sleep (%ld/%.2f). sleeping %.2f ms for %ld bytes, adjust %.2f ms retr.cmsecs >= 0bytes >= 0KB/sMB/sGB/s%7.2f %s%.2f %sGiving up. Retrying. sleep_between_retrievals: avg=%f,sleep=%f %s.%dhttp_proxyhttps_proxyftp_proxyError parsing proxy URL %s: %s. Error in proxy URL %s: Must be HTTP. mynewloc != NULL%d redirections exceeded. Removing file due to --delete-after in retrieve_from_file(): Could not seed OpenSSL PRNG; disabling SSL. OpenSSL: %s Warrining validation of Server Cert not possible! http://https://ftp://No errorUnsupported schemeEmpty hostBad port numberInvalid user nameUnterminated IPv6 numeric addressIPv6 addresses not supportedInvalid IPv6 numeric address0123456789ABCDEFurl.cp2 - newstr == newlenftp://%shttp://%serror_code >= 0 && error_code < countof (parse_errors)Removing %s because of directory danger! %s: %sq - TAIL (dest) == outlenindex.html?;#scheme_str != NULL*password*p - result == size@/?#;:/;?#/;?#;?#?#*p == 0%s: %s: Not enough memory. mallocreallocstrdup%02d:%02d:%02d%04d-%02d-%02d %02d:%02d:%02dutime(%s): %s Unlinking %s (symlink). Failed to unlink symlink `%s': %s %ldforkContinuing in background, pid %d. Output will be written to `%s'. /dev/nullhtmlhtm1%lldutils.csig == SIGALRM1.9.1WWWWWWWWWXXX XXXXX X$X(X,X0X4X8Xn)#5Fu[~Tv>ԙwQABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/CBBBBQ00000000000000000000000000000000  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~00020 000@0P2 `0 p0 0 0 0$3400000`b@KPc`kdpxxFhEm 0@`ppq rL s0S@HPNv`VApaB0CpPDeX0@gP`pGIilnOo 0Y@PQ`@RpTtU0Y0@ P`pwPp8d` @ P0@ PPJML(   Wpе`p 00@0P`0PP P P 0 p P P PPP``` 0@ptxll``ll(  0 l@@<Pl`lpl(xllLl8<( (0@ P0plllll 0@Phl`p0 dl`  llxl 0X@ Pl`p $,(TldXHl0<| ܲ0@Ptl`lpLl\l`\l tlplpll  0 @ P(`(p(l|lXlPlL<T<P`\WuWPh! aЮ 3D a`P0( a)/ a=@)\cjqx P0P` B a a Ppб  a07 ?@GPOW_аf0mt{в a@PD  aP PP  aL&,3;LJMaMou|г a(O 0 0`p 0'@/P7`? Z\dlt@|p_aFNV^fn0v~0   a@ ! *@3P<pENW`hpx@0`0 a Z  @ P ` p&  a4 < D L T \ d l t |    0 @ P    t    @   ! !!!@"!P*!`2!@:!`B!pJ!R!Z!b!j!0r! `[!@!p!!!!!!0!P!0!@!P!`!p!!" ["""&"."6" >"F"0N"@V"`^"f"n"`v"~"@" b""""" "@"`"p"""""""## #0#@&#P.#`6#p>#`D#pK#R#Y#`#g#n#u#|############## #0# b#($$H$($ ;$0A$H$O$0U$\$c$0j$ $`$P$ Db$p$$ $$$$$$`$ %0 %@%)%P1% 9%$K%R%Y%0`%g% o%pv%}%%%@%% P%%%%%% [%T;%%0 &8& &&&0.&2?&7J&0P&2a&$3r&0z&@&4&P&`&p&& &P&&&&&&&@&P'`'p'''''/'7' ?'0G'@O'PW'`_'pg'o'w'''''''''''0'?''0'P' ' `b(p((A"()(C<(pC(CV(0Do(w(dD( `( d( h( l((D( \(G)P)I!)`))H2) |A)@I)Q)Y)a)pi)pq) y)@)0) )) )`) )P)p))))))) *0 *@* x!* t/* p<* \K*S*p[*c* k*Ps*0{***** **0*****P***** +@ +P+`+p#+++3+;+C+K+S+[+c+k+`s+{+++++0+@+++ +@+++P++++ ,0,@,0 ,@), 1, 9, M,@V,p_,ph,q,z,,,,, ,`,,, ,P,`,,,,- -@-p-%--- 5-0=-@E-M-U-]-0e-0m-v---l--(-P--<---- -L....7. Q.0g.x.....p...../ /X/ܲ//LM/0V/@_/Ph/`q///// \/4/ܸ/ /`/0/ /0/0 000%0.0700@0@I0R0X0_0f0`m0t0{00 000@0P0`0p00000000000 101@1P1p'1/171?1G1O1W1_1g1o1w1 101@1P1`1p11111111111 102@2P2`2p'2/272?2G2O2W2_2g2o2w2 202@2P2`2p222`2222222 202@3P3`3p3'3/373?3G3O3W3_3g3d~33 3 3 3 3 3 3Q3 4444#4 A4H4O4 W4_4g4o4w44P4`44444444`4 444`4P5 555$5-5 350<5E5N5W5`5i5r5{55p5 55`5P555P5555 5P 5` 5 6 66"6@+646<60E6M6pV6_6h6p6x66p666660606@6@66 6P6`6p6677p7"7+7@47<7E7M70U7]7`f7n7pw777 7 7@777@77777P77 7 Q 8p88(8018:8@C80L8,d8@m80v8@8p8888 88@8`8p888888889 909@9`'9p/979?9G9O9W9_9g9o9 w909@9P9`9p999999999909@9P9`:p:::':/:7:?:G:O:W: _:0g:@o:Pw:`:p::::: : :0:::`::@:P:`:p; ;;;`W-;p9; @;G;0N;U;\;Pc;@j;0q;8};;p;0;d;;;;;;;;`;p ;@W <`<`< %<1<@A<pI<Q< h<p<v<}< < << <P<p<< pa<<<<<0=@ =0=@=#=+=3=;=C=,P=]=o=0w=@==p=0==== =P=@=p==0=@====>0 >P>>>%>,>@4>p<> D>L>T>\>c>j>0p>w>~> >0>@>P>>>>>> >>>3>  ? ? $'? ,5?@;?pB?I?P?0W?^? ap? x?? 4?@?0? H?P??0???? `?@ @ @@@`%@0-@@5@<@C@J@Q@W@^@e@Ws@$V@N@0@`@P@0@W@@@@ a@<\@A A_AO+A 3A@;APCA`KASA[AqfAnAvA~AAAA `A A0A@APA`AAAAAAAA0AB@ BPB B`$B 1Bp8B?BFBMB TB\BdB lB tB@ |Bp BBBؔBȘB B B BPBBȣC C C &C>C FC NC0VC lC      JM L(@  (2H 4 O     4.:  `>23 Q$-,\)U|5hIp0haSTgdtLtPn ;p yHJ,L ;  /(>LJD !,Gh,T]=ȟRDq[f yd4Dd, 7 M ] k  4 ;r<-$   К; p  X $ \@ (       g  ̢p  LE  | > $Nܺ%  =  YP<3C4L ,(3=Zit 0 H`83,  0 d R\ \^  ܇6p P g =d/L 2P@(   H+تr h ( T5  t hFQ}T (HpDH0G xlt42/%.1#H3  =]IqALZ l@̽4 Z:0Z6s K00V ($TQ+ x >yPliu< PL@CFHNakl&8:;&.,Q`w &.^ekm% ' , 5 ; C F I ] r     " ' , 6 = A B C F H I Q S V W Y Z \ ` h j G p x y  &   #$?HPY_dgmux'.24:Zbnvy)01IMNO]prtz{!"*-9J`cq|+Rs<DE(3B~ ;>AGX7=[\i  k},/568@FLQSTU^aefhjlow&   #$?HPY_dgmux'.24:Zbnvy)01IMNO]prtz{!"*-9J`cq|+Rs<DE(3B~ ;>AGX7=[\i  k},/568@FLQSTU^aefhjlow%KYt %;CWXHILVWyq_NXArgc_NXArgv___progname__dyld_func_lookup__start_environdyld_stub_binding_helperstart___keymgr_dwarf2_register_sections__cthread_init_routine__mh_execute_header_atexit_errno_exit_mach_init_routine_main_fnmatch___error_acceptport_bindport_closeport_conaddr_connect_to_many_connect_to_one_iread_iwrite_select_fd_set_connection_host_name_test_socket_open___eqdf2___fixdfsi___floatsidf___muldf3___subdf3_abort_accept_address_list_copy_one_address_list_get_bounds_address_list_release_address_list_set_faulty_bind_close_connect_debug_logprintf_getsockname_ip_default_family_listen_logprintf_lookup_host_map_ipv4_to_ip_memset_opt_pretty_print_address_printf_read_run_with_timeout_select_setsockopt_sockaddr_len_socket_strcmp_strerror_wget_sockaddr_get_port_wget_sockaddr_set_address_write_convert_all_links_convert_cleanup_downloaded_file_downloaded_files_free_register_delete_file_register_download_register_html_register_redirection___divdf3_count_char_dl_url_file_map_downloaded_html_set_fclose_fopen_fputs_free_free_keys_and_values_free_urlpos_fwrite_get_urls_html_hash_table_contains_hash_table_destroy_hash_table_get_hash_table_get_pair_hash_table_map_hash_table_put_hash_table_remove_html_quote_string_logputs_make_string_hash_table_numdigit_putc_read_file_read_file_free_rename_slist_free_slist_nreverse_slist_prepend_sprintf_strcpy_string_set_add_string_set_free_strlen_unlink_wtimer_delete_wtimer_elapsed_wtimer_new_xmalloc_real_xstrdup_real_cookie_jar_delete_cookie_jar_generate_cookie_header_cookie_jar_load_cookie_jar_new_cookie_jar_process_set_cookie_cookie_jar_save___adddf3___gtdf2___nedf2__sch_istable_asctime_cookies_now_datetime_str_ferror_fprintf_fputc_hash_table_count_http_atotm_localtime_make_nocase_string_hash_table_match_tail_memchr_memcmp_memcpy_qsort_read_whole_line_sscanf_strcasecmp_strchr_strdupdelim_strncasecmp_strncmp_time_ftp_get_listing_ftp_loop___sF__sch_tolower_accdir_acceptable_chmod_clearerr_fflush_file_exists_p_file_merge_fileno_ftp_cwd_ftp_index_ftp_last_respline_ftp_list_ftp_login_ftp_parse_ls_ftp_pasv_ftp_port_ftp_process_type_ftp_pwd_ftp_response_ftp_rest_ftp_retr_ftp_size_ftp_syst_ftp_type_ftruncate_get_contents_global_download_count_has_wildcards_p_legible_lstat_mkalldirs_printwhat_rbuf_discard_rbuf_initialize_rbuf_initialized_p_rbuf_uninitialize_readlink_remove_link_retr_rate_rewind_rotate_backups_search_netrc_sleep_between_retrievals_stat_strstr_symlink_time_str_total_downloaded_bytes_touch_url_file_name_url_set_dir_url_set_file_url_string__sch_toupper_calculate_skey_response_map_ip_to_ipv4_number_to_string_rbuf_read_bufferful_strncpy_strtok_strtol_xrealloc_real_atoi_fgetc_mktime_url_escape_gen_md5_context_size_gen_md5_finish_gen_md5_init_gen_md5_update_strcat_hash_table_clear_hash_table_new_ptrcmp_ptrhash_string_cmp_string_hash___umodsi3_header_exists_header_extract_number_header_get_header_process_header_strdup_skip_lws_rbuf_peek_accept_domain_address_list_match_all_herrmsg_host_cleanup_sufmatch_wget_sockaddr_get_addr_wget_sockaddr_set_port_gethostbyname_h_errno_inet_addr_inet_ntoa_xstrdup_lower_map_html_tags_cleanup_html_url_get_urls_file_interesting_attributes_interesting_tags_uri_merge_url_error_url_has_scheme_url_parse_http_cleanup_http_loop_http_process_set_cookie_connect_ssl_feof_file_size_fread_gmtime_has_html_suffix_p_init_ssl_scheme_default_port_shutdown_ssl_ssl_iwrite_ssl_printerrors_strptime_strrchr_url_full_path_version_string_wget_cookie_jar_cleanup_home_dir_initialize_run_command_setoptval___fixdfdi_exec_name_free_vec_getenv_getpwuid_getuid_merge_vecs_sepstring_valid_progress_implementation_p_log_close_log_init_log_request_redirect_output_log_set_flush_log_set_save_context_logflush_redirect_request_isatty_perror_unique_name_vfprintf_vsnprintf_fork_to_background_fstat_getopt_long_legible_large_int_optarg_optind_progress_handle_sigwinch_progress_schedule_redirect_putchar_puts_retrieve_from_file_retrieve_tree_retrieve_url_rewrite_shorthand_url_set_progress_implementation_signal_ssl_init_prng_url_scheme_MD5_Final_MD5_Init_MD5_Update_free_netrc_netrc_list_progress_create_progress_finish_progress_update___divsi3___gedf2___ledf2___ltdf2___modsi3___unorddf2_calc_rate_determine_screen_width_rbuf_flush_ssl_iread_frontcmp_res_get_specs_res_match_path_res_parse_res_parse_from_file_res_register_specs_res_retrieve_file_schemes_are_similar_p_string_set_contains_url_free_res_cleanup___fixunsdfsi_random_float_sleep_usleep_wtimer_allocate_wtimer_granularity_wtimer_reset_free_ssl_ctx_verify_callback_BIO_ctrl_ERR_error_string_ERR_get_error_OPENSSL_add_all_algorithms_noconf_RAND_egd_RAND_file_name_RAND_load_file_RAND_seed_RAND_status_SSL_CTX_free_SSL_CTX_load_verify_locations_SSL_CTX_new_SSL_CTX_set_verify_SSL_CTX_use_PrivateKey_file_SSL_CTX_use_certificate_file_SSL_connect_SSL_free_SSL_library_init_SSL_load_error_strings_SSL_new_SSL_pending_SSL_read_SSL_set_connect_state_SSL_set_fd_SSL_shutdown_SSL_write_SSLv23_client_method_SSLv2_client_method_SSLv3_client_method_TLSv1_client_method_X509_NAME_oneline_X509_get_subject_name_random_number_scheme_disable_file_non_directory_p_make_directory_strpbrk_slist_append_slist_contains_suffix_access_fgets_fork_freopen_fseek_ftell_gettimeofday_ioctl_malloc_mkdir_mmap_munmap_open_rand_realloc_setitimer_setsid_siglongjmp_sigsetjmp_snprintf_srand_strdup_utimedyld_content_lazy_binderdyld_func_lookup_pointerdyld__mh_execute_header_crt_basename_.str_.str1_.str2_connection_host_name_.str3_.str2_.str1_.str4_resolve_bind_address_bind_address_resolved.b_.str_bind_address_connect_with_timeout_callback_.str5_.str6_.str7_.str8_.str9_.str10_msock_.str11_.str12_.str13PCRELV0_replace_attr_downloaded_html_list_dl_file_url_map_.str9_.str10_.str11_.str12_.str13_.str14_.str15_converted_files.4066_.str2_.str16_.str17_.str18_.str19_.str20_.str5_.str4_.str6_.str3_.str22_.str23_.str24_.str25_.str26_dissociate_urls_from_file_mapper_.str7_.str8PCRELV1_downloaded_files_hash_v2.4315_v3.4316_v4.4317_v1.4314_df_free_mapper_.str_.str1_.str21_delete_cookie_find_matching_cookie1_store_cookie_.str_.str1_.str3_.str2_.str4_.str5_.str6_numeric_address_pPCRELV0_.str9_.str8_.str7_.str10_.str11_.str12_.str13_.str14_.str15_.str16_.str17_.str18_.str19_.str20_.str21_.str22_.str23_known_toplevel_domains.3726_.str31_.str32_.str33_.str34_.str35_.str36_cookie_matches_url_equality_comparator_goodness_comparator_.str37_.str38_.str39_.str40_.str41_.str42_save_cookies_mapper_.str43_.str44_.str45_.str46_.str47_.str48_.str49_.str50_.str51_.str52_.str53_nuke_cookie_chain_.str24_.str25_.str26_.str27_.str28_.str29_.str30_ftp_loop_internal_.str82_.str83_.str81_.str84_ftp_expected_bytes_.strPCRELV0PCRELV1_.str74_.str75_.str76_.str40_.str8_.str9_.str10_.str11_.str12_.str13_.str14_.str15_.str16_.str17_.str18PCRELV2_.str19_.str20_.str21_.str22_.str23_.str24_.str26_.str27_.str28_.str29_.str30_.str31_.str32_.str33_.str34_.str36_.str37_.str38_.str39_.str41_.str42_.str43_.str44_.str45_.str46_.str48_.str49_.str50_.str51PCRELV3_.str52_.str53_.str54_.str55_.str73_.str3_.str2_.str1_.str4_.str5_.str6_.str7_.str25_.str35_.str47_.str57_.str56_.str58_.str59_.str61_.str60_.str62_.str63_.str64_.str65_.str66_.str67_.str68_.str69_.str70_.str71_.str72_.str77_.str78_.str79_.str80_ftp_retrieve_globPCRELV4PCRELV5_ftp_retrieve_dirs_.str85_.str86_depth.13639_.str93_.str94_.str95_.str96_.str97_.str98_.str99_.str100_.str101_.str102_.str103_.str104_.str105_.str106_.str87_.str88_.str89_.str90_.str91_.str92_.str107_.str108_.str_ftp_request_.str1_.str2_.str3_.str4_.str5_.str6_.str7_.str8_skey_head.12703_.str11_.str12_.str13_.str14_.str15_numbuf.12980_.str16_.str17_.str18_.str19_.str20_.str21_.str22_.str23_.str24_.str25_.str26_.str27_.str28_.str29_.str9_.str10PCRELV0_ftp_parse_unix_ls_clean_line_.str12_.str13_.str36_.str37_.str15_.str38_.str39_.str40_.str41_.str42_.str43_.str56_.str57_.str58_.str59_.str60_.str61_.str62_.str63_months.12975_.str64_.str65_.str66_.str67_.str68_.str69_.str70_.str71_.str72_.str14_.str16_.str17_.str18_.str19_.str20_.str21_months.12654_.str22_.str23_.str24_.str25_.str26_.str27_.str28_.str29_.str30_.str31_.str32_.str33_.str34_.str35_.str73_.str74_.str75_.str76_.str77_.str78_.str79_.str80_.str81_.str82_.str83_.str84_.str85_.str86_.str87_.str88_.str89_.str90_.str91_.str92_.str93_.str94_.str95_.str96_.str_.str1_.str2_.str3_.str4_.str5_.str6_.str7_.str8_.str9_.str10_.str11_.str44_.str45_.str46_.str47_.str48_.str49_.str50_.str51_.str52_.str53_.str54_.str55_buf.3125_Wp_.str_primes.3208_string_hash_nocase_string_cmp_nocase_.str_.str2_.str1_.str_.str3_.str4_.str5_gethostbyname_with_timeout_callback_.str7_.str6_host_name_addresses_map_.str8_.str9_.str10_.str11_.str12_.str13_.str14_.str15_.str16_.str17_.str18_.str19_host_cleanup_mapper_.str20PCRELV0_convert_and_copy_.str8_.str6_.str5_.str9_.str10_.str2_.str3_.str4_.str7_.str47_.str48_known_tags_.str5_.str6_.str7_.str8_.str9_tag_url_attributes_collect_tags_mapper_.str49_tag_find_urls_append_url_.str39_.str38_.str37_tag_handle_base_find_attr_.str_tag_handle_form_tag_handle_link_.str40_.str41_tag_handle_meta_.str42_.str43_.str44_.str45_.str31_.str32_.str33_.str34_.str35_.str36_.str46_.str50_.str1_.str2_.str3_.str4_.str10_.str11_.str12_.str13_.str14_.str15_.str16_.str17_.str18_.str19_.str20_.str21_.str22_.str23_.str24_.str25_.str26_.str27_.str28_.str29_.str30_.str11_.str1_.str_post_file_.str2_.str3_.str4_.str5_chunk.12848_.str6_.str7_http_process_range_.str8_http_process_none_.str9_http_process_type_http_process_connection_.str10_invalidate_persistent_pc_active_p.b_pc_active_ssl_pc_last_host_ip_pc_last_fd_.str12_free_hstat_time_formats.14136_basic_authentication_encode_.str17_tbl.14154_.str18_gethttp_ssl_ctx.13140_.str28_.str31_.str30_.str32_.str29_.str52_.str43_.str65_.str64_pc_last_port_.str33_pc_last_ssl_.str34_.str35_.str36_.str37_.str40_.str41_.str42_.str44_.str45_.str46_.str47_.str48_.str49_nonce.14281_opaque.14280_realm.14279_options.14285_.str23_.str19_.str24_.str25_.str50_.str51_.str55_.str53_.str54_.str59_.str57_.str56_.str58_.str60_.str61_.str62_.str63_.str66_.str67_.str68_.str69_.str70_.str72_.str73_.str74_.str75_.str76_.str77_.str78_.str79_.str80_.str81_.str82_.str83_.str71_.str84_.str87_.str90_.str91_.str92_.str93_.str94_.str95_.str96_.str38_.str39_.str85_.str86_.str88_.str89_.str97_.str98_.str99_.str100_.str101_.str102_.str104_.str103_.str105PCRELV0PCRELV1_cookies_loaded_p.b_.str106_.str107_.str109_.str110_.str111_.str112_.str113_.str114_.str115_.str116_.str117_.str118_.str119_.str120_.str121_.str122_.str123_.str124_.str125_.str126_.str127_.str128_.str129_.str130_.str13_.str14_.str15_.str16_.str20_.str21_.str22_.str26_.str27_.str108_.str100_cmd_vector_cmd_boolean_.str116_cmd_number_.str120_cmd_string_cmd_time_simple_atof_.str123_cmd_directory_cmd_file_cmd_spec_dirstruct_cmd_bytes_parse_bytes_helper_.str122_enable_tilde_expansion.b_cmd_directory_vector_cmd_spec_header_.str125_cmd_spec_htmlify_cmd_spec_mirror_cmd_number_inf_.str121_cmd_lockable_boolean_.str117_.str118_.str119_cmd_spec_progress_.str124_cmd_bytes_large_cmd_spec_recursive_cmd_spec_restrict_file_names_.str126_.str127_.str128_.str129_cmd_spec_timeout_cmd_spec_useragent_.str130_findcmd_commands_parse_line_run_wgetrc_.str104_.str105_.str103_.str102_.str101_.str106_.str107_.str108_.str109_.str110_.str111_.str112_.str113_.str114_.str115_.str_.str1_.str2_.str3_.str4_.str5_.str6_.str7_.str8_.str9_.str10_.str11_.str12_.str13_.str14_.str15_.str16_.str17_.str18_.str19_.str20_.str21_.str22_.str23_.str24_.str25_.str26_.str27_.str28_.str29_.str30_.str31_.str32_.str33_.str34_.str35_.str36_.str37_.str38_.str39_.str40_.str41_.str42_.str43_.str44_.str45_.str46_.str47_.str48_.str49_.str50_.str51_.str52_.str53_.str54_.str55_.str56_.str57_.str58_.str59_.str60_.str61_.str62_.str63_.str64_.str65_.str66_.str67_.str68_.str69_.str70_.str71_.str72_.str73_.str74_.str75_.str76_.str77_.str78_.str79_.str80_.str81_.str82_.str83_.str84_.str85_.str86_.str87_.str88_.str89_.str90_.str91_.str92_.str93_.str94_.str95_.str96_.str97_.str98_.str99_check_redirect_output_saved_append_inhibit_logging.b_logfp_save_context_p_flush_log_p.b_needs_flushing.b_trailing_line_log_line_current_log_lines_logvprintf_.str1_.str_.str2_redirect_request_signal_name_.str3_.str4PCRELV0_.str97_.str34_.str98_.str99_.str100_.str101_.str102_.str103_.str104_.str105_.str106_.str37_.str107_.str108_.str109_.str110_.str111_.str112_.str1_.str3_.str5_.str113_.str114_.str115_.str116_.str_.str117_.str118_.str119_.str120_.str121_.str122_.str123_.str124_.str125_.str126_.str127_.str128_.str129_.str130_.str15_.str36_.str131_.str132_.str133_.str25_.str27_.str134_.str135_.str136_.str137_.str138_.str139_.str140_.str141_.str58_.str142_.str59_.str143_.str144_.str145_.str41_.str96_.str146_.str46_.str147_.str148_.str73_.str149_.str85_.str87_.str88_.str150_.str90_.str91_.str92_.str93_.str94_.str151_.str152_.str153_.str154_.str155_.str156_.str157_.str39_.str158_.str42_.str44_.str51_.str159_.str57_.str160_.str161_.str162_.str163_.str164_.str165_.str166_.str77_.str79_.str82_.str83_.str167_.str95_.str168_.str169_.str170_long_options.12764_.str171_.str172_.str173_.str175_.str174_.str177_.str176_redirect_output_signal_.str178_.str179_.str180_.str181_.str182_.str183_.str185_.str186_.str184_.str2_.str4_.str6_.str7_.str8_.str9_.str10_.str11_.str12_.str13_.str14_.str16_.str17_.str18_.str19_.str20_.str21_.str22_.str23_.str24_.str26_.str28_.str29_.str30_.str31_.str32_.str33_.str35_.str38_.str40_.str43_.str45_.str47_.str48_.str49_.str50_.str52_.str53_.str54_.str55_.str56_.str60_.str61_.str62_.str63_.str64_.str65_.str66_.str67_.str68_.str69_.str70_.str71_.str72_.str74_.str75_.str76_.str78_.str80_.str81_.str84_.str86_.str89PCRELV0_processed_netrc.3173.b_.str1_.str_.str2_.str3_.str4_.str5_.str6_.str7_.str8_.str9_.str10_.str11_implementations_dot_create_.str3_.str2_.str4_.str5_.str6_.str9_.str8_.str7_dot_update_.str12_.str10_.str11_dot_finish_.str13_dot_set_params_.str14_.str15_.str16_.str17_.str18_bar_create_create_image_screen_width_.str38_.str37_bar_update_bar_finish_bar_set_params_.str39_.str40_current_impl_locked.b_.str41_.str_.str1_current_impl_output_redirected.b_.str19_.str20_.str23_.str24_.str25_short_units.12426_.str30_.str31_.str33_.str34_.str35_.str36_.str21_.str22_.str26_.str27_.str28_.str29_.str32_url_enqueue_url_dequeue_download_child_p_.str16_.str17_.str20_.str19_.str18_.str21_.str22_.str23_.str24_.str26_.str25_.str27_.str29_.str28_.str30_.str_.str1_.str2_.str3_.str4_.str5_.str6_.str7_.str8_.str9_.str10_.str11_.str12_.str13_.str14_.str15_.str2_.str1_.str_.str3_.str4_.str5_.str6_.str7_.str8_.str9_.str10_.str12_.str11_.str13_registered_specs_.str14_.str15_cleanup_hash_table_mapper_dlbuf.12893_limit_data.0_limit_data.1_limit_data.2_.str_.str1_.str4_.str3_.str2_.str5_rate_names.12943_.str11_.str10_res.12942_.str13_.str12_first_retrieval.13116.b_.str14_.str15_.str16_.str17_.str18_.str19_rewritten_storage.13190_.str20_.str21_.str22_.str23_.str24_.str25_.str26_.str6_.str7_.str8_.str9_.str_.str1_.str2_url_escape_1_url_unescape_urlchr_table_.str11_.str14_.str13_.str12_supported_schemes_.str15_.str16_.str17_parse_errors_full_path_write_.str18_.str19_append_uri_pathel_filechr_table_.str20_.str21_.str22_.str23_.str24_.str25_sync_path_.str26_.str27_.str28_.str29_.str30_.str31_.str32_.str_.str1_.str2_.str3_.str4_.str5_.str6_.str7_.str8_.str9_.str10_memfatal_.str1_.str_.str2_.str3_output.4084_.str4_output.4097_.str5_.str6_.str7_.str8_.str9_.str10_.str11_.str12_.str13_.str14_.str15_.str16_.str17_proclist_in_acclist_.str18_.str19_.str20_string_set_free_mapper_free_keys_and_values_mapper_legible_1_outbuf.4635_.str21_seeded.4954.b_abort_run_with_timeout_.str24_.str23_.str22_run_with_timeout_env_.str